[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57051.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.128.1
:421 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  42->211 1ezfA  a.128.1.2 * 1e-05 15.4 %
:HMM:SCOP  30->211 1ezfA_ a.128.1.2 * 9.9e-08 29.5 %
:HMM:PFM   43->211 PF00494 * SQS_PSY 6.3e-07 29.6 152/267  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57051.1 GT:GENE BAD57051.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2378228..2379493 GB:FROM 2378228 GB:TO 2379493 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57051.1 LENGTH 421 SQ:AASEQ MTAGRLGPLVHGLRRLRRAPDLAALRAAATPAELAARALIPAGRNLGLAVGLLPAGQRAEATAALLACRVLDAYEDLMDRPHAGAAVLAAAGYLGGRTDTAPPPLRAVADRDSEAVDLVLAERAPDIRLLVGALPAPGRARVAALLDDVAAVMARNLATPLPRTAYGAGVLGRVIHHACELVAGAAYADDELRELAECVGITAQLANDLRDGELALYGAADRADLTRTVLLRVLSPALGSLALLGTLGPRTPGLSARAGMAYLAITTTAFLCSAAGAAPPYPRRLRLPAAVLAAAAPGYWGRMQNRMLGSVDRAIHLVLDAAPELTEPAGDAPPMLAALDHRPTAHTLGPLVVGTAFALVEALPPDRLTGGVPAAQARRMMIADHLAFGALERIAPGDVEAMRQLAVRFQLAAQHTGGGST GT:EXON 1|1-421:0| SEG 13->39|lrrlrrapdlaalraaatpaelaaral| SEG 83->96|agaavlaaagylgg| SEG 139->155|rarvaallddvaavmar| SEG 234->254|lspalgslallgtlgprtpgl| SEG 274->297|aagaappyprrlrlpaavlaaaap| HM:PFM:NREP 1 HM:PFM:REP 43->211|PF00494|6.3e-07|29.6|152/267|SQS_PSY| RP:SCP:NREP 1 RP:SCP:REP 42->211|1ezfA|1e-05|15.4|169/323|a.128.1.2| HM:SCP:REP 30->211|1ezfA_|9.9e-08|29.5|173/0|a.128.1.2|1/1|Terpenoid synthases| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 417-421| PSIPRED ccccHHHHHHHHHHHHHHcccHHHHHHHccHHHHHHHHHccccccccEEEEEccccccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHcccccccccccHHHHHccccHHHEEHHHcccccEEEEEEccccccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHccccccEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHcccccccccHHccHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHcccccHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHccccccc //