[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57053.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  39/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
:288 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   70->229 PF07298 * NnrU 1e-05 31.7 %
:HMM:PFM   70->247 PF07298 * NnrU 5e-11 23.6 148/192  
:BLT:SWISS 64->249 NRM_XENLA 6e-07 30.8 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57053.1 GT:GENE BAD57053.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2380550..2381416 GB:FROM 2380550 GB:TO 2381416 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57053.1 LENGTH 288 SQ:AASEQ MDLTLAQQVRGALADRRRLVPLLLAFAGYAFAGVTVPLLLLFAGGWWLPKTVDTGAHLPAAWAVPIDLGLLALFGLQHSAMARPAVKAVVIRWVPEPLERTVYVVAASAVVWVVCLGWQPLPQPIWSAHGAVGAVLDAGFWLGFVLVYVATLLLDHFHLLGLGQAYRHYVRQVPDATADRLQVHGPYRLVRHPLMTGLLLSFWCASTLTLGHLLWAVGLTGYIVLGTILEERDLSARFGAAYRDYATAVPAFFPSPLGPAARARLRRARPLGAGLAGGAGRVGGEEST GT:EXON 1|1-288:0| BL:SWS:NREP 1 BL:SWS:REP 64->249|NRM_XENLA|6e-07|30.8|182/285| TM:NTM 5 TM:REGION 22->44| TM:REGION 64->86| TM:REGION 100->122| TM:REGION 135->157| TM:REGION 200->222| SEG 22->33|lllafagyafag| SEG 102->114|vyvvaasavvwvv| SEG 152->163|llldhfhllglg| SEG 256->281|plgpaararlrrarplgaglaggagr| RP:PFM:NREP 1 RP:PFM:REP 70->229|PF07298|1e-05|31.7|139/197|NnrU| HM:PFM:NREP 1 HM:PFM:REP 70->247|PF07298|5e-11|23.6|148/192|NnrU| OP:NHOMO 43 OP:NHOMOORG 41 OP:PATTERN -------------------------------------------------------------------- ---------------1111-1---1-11111111111-11----------------------------------------------------------------------------------------------------------11-111------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------211---1------------------1--1--------------------1-1-------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------1-----------1---------------------------------------------------------------------------------------------------------------------------------------------1- -----------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------2---------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 257-274, 279-288| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHccccccccccHHHHHHHHcccccccccccccccccccccc //