[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57063.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:154 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57063.1 GT:GENE BAD57063.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2391576..2392040) GB:FROM 2391576 GB:TO 2392040 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57063.1 LENGTH 154 SQ:AASEQ MIRRRCHTAGVAGVWMGEHPSPKEYSMNLALWIAAGLLAFVALGGGVGKTFFPVEKLAAAPGGGWTAAVRPGFVRTLGGVELLAAAGLILPPLLGIAPALVPVTAACWVVLMIGAIITHVRHDGWGVFVALNVTYLLLAAFIAWGRFGPQPFAA GT:EXON 1|1-154:0| TM:NTM 3 TM:REGION 29->51| TM:REGION 88->110| TM:REGION 128->150| SEG 34->48|aagllafvalgggvg| SEG 77->103|lggvellaaaglilppllgiapalvpv| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7, 152-154| PSIPRED ccccHHHHccccEEEcccccccHHHHHHHHHHHHHHHHHHHHHcccccHHcccHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEHHHHHHHHHHHHHHHHHHcccccccc //