[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57068.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  78/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:248 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   54->122 PF09347 * DUF1989 4e-07 37.7 %
:HMM:PFM   40->131 PF09347 * DUF1989 3.6e-28 39.1 92/167  
:HMM:PFM   132->185 PF09347 * DUF1989 2.2e-09 38.9 54/167  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57068.1 GT:GENE BAD57068.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2396836..2397582) GB:FROM 2396836 GB:TO 2397582 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57068.1 LENGTH 248 SQ:AASEQ MTASTTLARAHARAQEAAATVATPDLPADVPAEAITFARRIPPGGYANVVLGRGTRVRLADPAGHACAHLLLLRAEAPWERLNVADTVKVPWQAYLGQGHPLLSDQGRLLATVLADGSGHHDALCGPGPAARAGLRLAAAKHGLGPRDVGPSLSFFRGVRVAADGALTPTGGAGAGAAVDLLIHLPVTLLVVDAEHPLDPAPVTDLDVVAWAAPELLAENHSDEPEYRRARHNTEEAWRAARSKENHR GT:EXON 1|1-248:0| SEG 8->22|araharaqeaaatva| SEG 123->145|alcgpgpaaraglrlaaakhglg| SEG 162->178|aadgaltptggagagaa| RP:PFM:NREP 1 RP:PFM:REP 54->122|PF09347|4e-07|37.7|69/167|DUF1989| HM:PFM:NREP 2 HM:PFM:REP 40->131|PF09347|3.6e-28|39.1|92/167|DUF1989| HM:PFM:REP 132->185|PF09347|2.2e-09|38.9|54/167|DUF1989| OP:NHOMO 78 OP:NHOMOORG 78 OP:PATTERN -------------------------------------------------------------------- --1-1--1------1----------1-------1111111----1----1--1-1------------1---------------------------------------------------------------------------------1----------------1------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111-------1------111-1------------11-11-1---1----111-111--11-------------1-1111111--------------------------------------1---------1111--------11-------11-------------------1----------------111--1-----------------------------1-----------------------1----------------------------------------11---------1----------------------------------1-11--------------------------------------------------------------------------------------------1-1----1111------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 6-8, 245-248| PSIPRED cccccccccHHHHHHHcccccccccccccccHHHHHHHHcccccccEEEEEccccEEEEEEccccEEEEEEEEcccccHHHcccHHHHHHHcccccccccEEEEccccEEEEEEEccccccccccccccccHHHHHHHHHHHcccccccccEEEEEEccccccccEEEEccccccccEEEEEEcccEEEEEEccccccccccccccEEEEEccccccccccccccccccccccHHHHHHHHHHHHccc //