[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57069.1
DDBJ      :             putative amino acid permease
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  95/915 : Eukaryota  27/199 : Viruses  0/175   --->[See Alignment]
:510 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   79->117,232->367 PF00324 * AA_permease 3e-05 27.1 %
:HMM:PFM   64->491 PF00324 * AA_permease 2.9e-25 20.0 416/479  
:BLT:SWISS 21->467 AAP2_NEUCR 1e-12 25.1 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57069.1 GT:GENE BAD57069.1 GT:PRODUCT putative amino acid permease GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2397653..2399185) GB:FROM 2397653 GB:TO 2399185 GB:DIRECTION - GB:PRODUCT putative amino acid permease GB:PROTEIN_ID BAD57069.1 LENGTH 510 SQ:AASEQ MATTLTPPSDTTDSTDSTDLQRFGYQPVLHRKLGRYASFAAGFSFVSILTTIFQFFGFGYGFGGAAFFWTWPVVFAGQLLVALNFAELAARYPISGCIYQWSRRLAGETIGWFAGWMMIIAQIVTAAAAAIALQVVLPSIWSGFQIIGEDTALTSPSGAMNAVLLGSVLLILTTLVNVVGIEWMSRLNTIGVTIEIVGVLAAIGVFFTHVERGPGVVLDTTAAAPGPYWAAFLVSGLMAAYVMVGFDSAGELSEETKNPRRVAPRTILTALSVSALGGGLMLLGALMAAPSLTDGMLAADGLAYVISAKLDSPAGTLLLGCVAVAILVCTLAIQTAGSRLMFSMARDGKLPFAAQLAAVHPRFGTPVLPAVVIGVLGITLLLVNLGNAAIFSTLASVCIVTLYVAYLLVTVPLLVRRLRGWPADETAPAGLFRLGRFGIPVNLLAVVWGLAMVVNLAWPRPEVYTPEGGGWWMLWSAPLFLAATVGVGVVVQRLVTMSAGRRAVPAVAPA GT:EXON 1|1-510:0| BL:SWS:NREP 1 BL:SWS:REP 21->467|AAP2_NEUCR|1e-12|25.1|422/541| TM:NTM 12 TM:REGION 36->58| TM:REGION 66->88| TM:REGION 116->138| TM:REGION 160->182| TM:REGION 195->217| TM:REGION 230->252| TM:REGION 267->289| TM:REGION 313->335| TM:REGION 365->387| TM:REGION 394->415| TM:REGION 437->459| TM:REGION 472->494| SEG 3->20|ttltppsdttdstdstdl| SEG 53->68|fqffgfgygfggaaff| SEG 119->137|iiaqivtaaaaaialqvvl| SEG 163->179|vllgsvllilttlvnvv| SEG 275->289|alggglmllgalmaa| SEG 371->387|vvigvlgitlllvnlgn| SEG 400->419|vtlyvayllvtvpllvrrlr| SEG 485->491|vgvgvvv| SEG 501->509|rravpavap| RP:PFM:NREP 1 RP:PFM:REP 79->117,232->367|PF00324|3e-05|27.1|172/429|AA_permease| HM:PFM:NREP 1 HM:PFM:REP 64->491|PF00324|2.9e-25|20.0|416/479|AA_permease| GO:PFM:NREP 3 GO:PFM GO:0006810|"GO:transport"|PF00324|IPR004841| GO:PFM GO:0016020|"GO:membrane"|PF00324|IPR004841| GO:PFM GO:0055085|"GO:transmembrane transport"|PF00324|IPR004841| OP:NHOMO 189 OP:NHOMOORG 124 OP:PATTERN --------------------------------------------------1-1--------------- ---11--1------1------3--14-----1444411541---1----1--212-------1---2531-------------------------------------------------------------------------------------------------------------------------1--11111121-121222------1211------1111112--------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------11---1------------------22222222------------------------------------------------111-12-----11--------11-2111---------------1----------------1----------------------------------1--------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------12-2122--2111--1-------------------------------------------11----------------------------------------------------- ----------------1------212--------12------------1--112---------------1----1--------1-1------1--1-------131-----------------------------------------------------------------------------1112231-1------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-27| PSIPRED cccccccccccccccHHHHHHHHccccHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHccccHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHcEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccc //