[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57074.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  7/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.66.1
:297 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   102->225 2an3B PDBj 6e-08 18.5 %
:RPS:SCOP  110->229 2avnA1  c.66.1.41 * 9e-10 32.4 %
:HMM:SCOP  101->291 1r74A_ c.66.1.5 * 2.8e-20 32.4 %
:RPS:PFM   152->227 PF08241 * Methyltransf_11 2e-04 36.0 %
:HMM:PFM   152->242 PF08241 * Methyltransf_11 2.4e-12 28.7 87/95  
:BLT:SWISS 81->145 SOL3_YEAST 6e-04 32.3 %
:BLT:SWISS 140->219 UBIE_THET2 4e-07 37.5 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57074.1 GT:GENE BAD57074.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2404261..2405154 GB:FROM 2404261 GB:TO 2405154 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57074.1 LENGTH 297 SQ:AASEQ MTGLTLRPLNPLAPAGGTRYDDGSVRVRSQQSAGWWVPGVRTAHFTVRETEGRVEIVHRLPPERLDNNLGGMIVDELIHAELIAPEMFERVFVGVVRTCADDPAAAWRLFYDNTLAQIRRCWDSPNPPPTHIAQIAPVYRRALGLVPPGRVLDMGSCFGFFPLLLADAGQHRVLATDVVPGSMNLLRTIAQARGSAVGTMSCDAAAVPLPDRCVDTVTVLHLLEHLDRAHGRAVLAEAVRLAAQRVIVAVPFEDEPDPSYGHIRTFDTGELSVLGIETGLPFTVAEYHGGWLILDTR GT:EXON 1|1-297:0| BL:SWS:NREP 2 BL:SWS:REP 81->145|SOL3_YEAST|6e-04|32.3|65/249| BL:SWS:REP 140->219|UBIE_THET2|4e-07|37.5|80/220| SEG 232->246|ravlaeavrlaaqrv| RP:PDB:NREP 1 RP:PDB:REP 102->225|2an3B|6e-08|18.5|119/269| RP:PFM:NREP 1 RP:PFM:REP 152->227|PF08241|2e-04|36.0|75/96|Methyltransf_11| HM:PFM:NREP 1 HM:PFM:REP 152->242|PF08241|2.4e-12|28.7|87/95|Methyltransf_11| GO:PFM:NREP 2 GO:PFM GO:0008152|"GO:metabolic process"|PF08241|IPR013216| GO:PFM GO:0008168|"GO:methyltransferase activity"|PF08241|IPR013216| RP:SCP:NREP 1 RP:SCP:REP 110->229|2avnA1|9e-10|32.4|105/246|c.66.1.41| HM:SCP:REP 101->291|1r74A_|2.8e-20|32.4|176/0|c.66.1.5|1/1|S-adenosyl-L-methionine-dependent methyltransferases| OP:NHOMO 7 OP:NHOMOORG 7 OP:PATTERN -------------------------------------------------------------------- -------------------------1------1---1111--------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 276 STR:RPRED 92.9 SQ:SECSTR ################EEGGGGTcTTEEEEEETTEEEHHEEEccHHHHHHHHHHHHHHHHHTccccHHHHHHHHHHHTHHHcccTTcccEEEEcccccccEcHHHHHHHHHcTTTTcHHHHcccTTcHHHHcHHHHHHHHHTTccccccEEEEETcTTccGGGTTTTTTccEEEEEEccHHHHHHHHHHHTTcTTccccHHHHHHHHHHHTccccHHHHHHHHHHccGGGHHHHHHHHHEEEEEEEEEEEEEcccccTTccHHHHHHHccHHHHHHTcEEEcccEEEccccc##### DISOP:02AL 1-2| PSIPRED cccccccccccccccccccccccEEEEEEEccccccccccccccEEEEccccEEEEEEEccHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHcccccEEEEEccccHHHHHHHHccccEEEEEEccHHHHHHHHHHHHHccccEEEEEEEcccccccccccHHHHHHHHHHHccHHHHHHHHHHHHHHHcccEEEEEEEcccccccccccccccHHHHHHHHHHHcccEEEEEccccEEEEEcc //