[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57075.1
DDBJ      :             putative phenol hydroxylase
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  344/915 : Eukaryota  9/199 : Viruses  0/175   --->[See Alignment]
b.43.4c.25.1d.115.1d.15.4
:342 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   21->309 1krhA PDBj 3e-30 30.2 %
:RPS:PDB   17->333 1amoA PDBj 2e-35 10.2 %
:RPS:SCOP  2->89 1krhA3  d.15.4.2 * 5e-20 33.0 %
:RPS:SCOP  65->256 1pvwA  d.115.1.2 * 2e-23 10.0 %
:RPS:SCOP  227->335 1cqxA3  c.25.1.5 * 5e-13 16.5 %
:HMM:SCOP  2->89 1doiA_ d.15.4.1 * 1.3e-24 51.2 %
:HMM:SCOP  96->198 1tvcA1 b.43.4.2 * 7.3e-29 38.8 %
:HMM:SCOP  189->327 1i7pA2 c.25.1.1 * 2e-41 45.3 %
:RPS:PFM   21->81 PF00111 * Fer2 3e-05 41.8 %
:RPS:PFM   107->200 PF00970 * FAD_binding_6 6e-15 44.1 %
:RPS:PFM   222->309 PF00175 * NAD_binding_1 9e-13 43.2 %
:HMM:PFM   210->310 PF00175 * NAD_binding_1 1.5e-24 41.0 100/109  
:HMM:PFM   108->200 PF00970 * FAD_binding_6 1.1e-23 35.9 92/99  
:HMM:PFM   15->82 PF00111 * Fer2 2.9e-16 42.2 64/77  
:BLT:SWISS 4->342 DMPP_PSEUF 1e-57 38.1 %
:PROS 38->46|PS00197|2FE2S_FER_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57075.1 GT:GENE BAD57075.1 GT:PRODUCT putative phenol hydroxylase GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2405177..2406205) GB:FROM 2405177 GB:TO 2406205 GB:DIRECTION - GB:PRODUCT putative phenol hydroxylase GB:PROTEIN_ID BAD57075.1 LENGTH 342 SQ:AASEQ MAEFRVTVPTAGNPVTCRDDQTILDAFLRNGVWLPNSCNQGTCGTCKLRVVAGHVDHAGSPEYTLTAEERAQGLALGCQSRPRSDLVVEPLADTTDAVARFPLRDLTATVVSLDPIARDTRRLVLEVDGALDFLPGQYAQLHVPGTECWRPYSMANSPARPHRLEFHIRYSDGGVATGWIFHGLTVGDRVELRGPLGDFVLDDADHPLLLLAGGTGLAPLSAMLRAALERGHRSPIHLYHGVREEADLYDVEWLSELSRSHPDFHYTPCLSRGEWNGRTGYVGDAVLADFDNLRDYSGYLCGPPAMVEAAGRALKRRRMAPRRIFREKFTDAVTVGQELASA GT:EXON 1|1-342:0| BL:SWS:NREP 1 BL:SWS:REP 4->342|DMPP_PSEUF|1e-57|38.1|339/353| PROS 38->46|PS00197|2FE2S_FER_1|PDOC00175| SEG 201->220|lddadhpllllaggtglapl| SEG 312->323|ralkrrrmaprr| BL:PDB:NREP 1 BL:PDB:REP 21->309|1krhA|3e-30|30.2|285/337| RP:PDB:NREP 1 RP:PDB:REP 17->333|1amoA|2e-35|10.2|314/601| RP:PFM:NREP 3 RP:PFM:REP 21->81|PF00111|3e-05|41.8|55/71|Fer2| RP:PFM:REP 107->200|PF00970|6e-15|44.1|93/99|FAD_binding_6| RP:PFM:REP 222->309|PF00175|9e-13|43.2|88/107|NAD_binding_1| HM:PFM:NREP 3 HM:PFM:REP 210->310|PF00175|1.5e-24|41.0|100/109|NAD_binding_1| HM:PFM:REP 108->200|PF00970|1.1e-23|35.9|92/99|FAD_binding_6| HM:PFM:REP 15->82|PF00111|2.9e-16|42.2|64/77|Fer2| GO:PFM:NREP 6 GO:PFM GO:0009055|"GO:electron carrier activity"|PF00111|IPR001041| GO:PFM GO:0051536|"GO:iron-sulfur cluster binding"|PF00111|IPR001041| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00970|IPR008333| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00970|IPR008333| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00175|IPR001433| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00175|IPR001433| RP:SCP:NREP 3 RP:SCP:REP 2->89|1krhA3|5e-20|33.0|88/104|d.15.4.2| RP:SCP:REP 65->256|1pvwA|2e-23|10.0|190/219|d.115.1.2| RP:SCP:REP 227->335|1cqxA3|5e-13|16.5|109/142|c.25.1.5| HM:SCP:REP 2->89|1doiA_|1.3e-24|51.2|86/128|d.15.4.1|1/1|2Fe-2S ferredoxin-like| HM:SCP:REP 96->198|1tvcA1|7.3e-29|38.8|103/0|b.43.4.2|1/1|Riboflavin synthase domain-like| HM:SCP:REP 189->327|1i7pA2|2e-41|45.3|139/0|c.25.1.1|1/1|Ferredoxin reductase-like, C-terminal NADP-linked domain| OP:NHOMO 707 OP:NHOMOORG 356 OP:PATTERN ---------------------------1-2--------------1----------------------- -2-22--1111---2--22-22--35222222244441A9-11---------1-------411-1-311-------------------------------1--------------------------------------------111---------1-1111-----------------------------------------------------------------------------------------------------------------------------------------------------------------1----------1-1------------1------------------------11--------12146--1---------------2-12211512----122-1-1212-1-4-----11-11-1-111111114---1----------------------------------1---15333533334533333336333313967274611443462311421241144111111111111111177--11----------------------1-11---------------------------3322112---1-12------3222-1112-25----212------11-11112111211122-12221112121111121133331-1-12122122122122221211111111-122222222222--11-----2222321-1111--1---------2222212-1-5-33241543325334222111111111223222222232222--------------1---11--------------1-------------------------1-111-1------ -------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------111-111----11---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 337 STR:RPRED 98.5 SQ:SECSTR EEEEEEcTTccEEEEEcccccHHHHHHHHHHHTccccccccEEcccTTccccccccccccHHHHHHHTccccccccHHHHHHGGGGcccHHHHHHHHTTccccHHHHHHHHHTTTTTccHHHHHHTTHcTTccccHHHHHHHcccccccEEEEccccTTTcTTEEEEEEccEEEcTTccEEEcHccccEEEEEEEcccccccccTTccEEEEEEGGGGHHHHHHHHHHHHHHTcEEEEEEEccTTTccTTHHHHHHHHHTTcccEEEEEETTcccHHHHHHHTHHHHHHHHHHTccEEEEEEETTTHHHHHHHHHHHHHHHTTccHHHHHHHHHTTc##### DISOP:02AL 333-342| PSIPRED ccEEEEEEEcccEEEEEcccccHHHHHHHccccccccccccccccEEEEEEEccEEccccccccccHHHHHcccEEEEEcccccccEEEccccccccccccccEEEEEEEEEEEEEcccEEEEEEEcccccccccccEEEEEEcccccEEEEEEccccccccEEEEEEEEccccHHHHHHHHHcccccEEEEEEcccccccccccccEEEEEccHHHHHHHHHHHHHHHccccccEEEEEEEccHHHHHHHHHHHHHHHHcccEEEEEEEccccccccccccHHHHHHHcccccccEEEEEccHHHHHHHHHHHHHccccHHHcEEEEEccccccccccccc //