[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57081.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  17/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:96 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   47->89 PF07690 * MFS_1 0.00022 37.2 43/353  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57081.1 GT:GENE BAD57081.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2412503..2412793) GB:FROM 2412503 GB:TO 2412793 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57081.1 LENGTH 96 SQ:AASEQ MSTEARRFDPAQPYRLAPSVAVRPEPFGALLYDYTTRRLSFLKTPTLVRVVQSLATQPAASAALTAAAIPVPERPRYLAALAELAAAGTIQLRSPA GT:EXON 1|1-96:0| SEG 52->68|qslatqpaasaaltaaa| SEG 78->87|laalaelaaa| HM:PFM:NREP 1 HM:PFM:REP 47->89|PF07690|0.00022|37.2|43/353|MFS_1| OP:NHOMO 18 OP:NHOMOORG 17 OP:PATTERN -------------------------------------------------------------------- -----------------11-11--1111111111112-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 93-96| PSIPRED ccccccccccccccccccEEEEcccccHHHHHHHHHHEEEccccHHHHHHHHHHccccHHHHHHHHcccccccccHHHHHHHHHHHcccccccccc //