[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57084.1
DDBJ      :             putative two-component system response regulator
Swiss-Prot:             

Homologs  Archaea  17/68 : Bacteria  731/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
a.4.6c.23.1
:222 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   15->219 3c3wB PDBj 2e-27 33.2 %
:RPS:PDB   15->222 3c3wA PDBj 1e-31 37.6 %
:RPS:SCOP  13->204 1s8nA  c.23.1.1 * 2e-21 22.5 %
:RPS:SCOP  176->222 1fseF  a.4.6.2 * 2e-12 27.7 %
:HMM:SCOP  9->143 1k66A_ c.23.1.1 * 7.5e-27 31.1 %
:HMM:SCOP  140->222 1p4wA_ a.4.6.2 * 2e-21 41.0 %
:RPS:PFM   17->132 PF00072 * Response_reg 1e-10 30.6 %
:RPS:PFM   161->209 PF00196 * GerE 2e-07 59.2 %
:HMM:PFM   17->131 PF00072 * Response_reg 2.8e-26 30.6 111/112  
:HMM:PFM   160->214 PF00196 * GerE 2.2e-21 50.9 55/58  
:BLT:SWISS 14->222 DEGU_BACSU 2e-34 37.9 %
:PROS 176->203|PS00622|HTH_LUXR_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57084.1 GT:GENE BAD57084.1 GT:PRODUCT putative two-component system response regulator GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2415823..2416491 GB:FROM 2415823 GB:TO 2416491 GB:DIRECTION + GB:PRODUCT putative two-component system response regulator GB:PROTEIN_ID BAD57084.1 LENGTH 222 SQ:AASEQ MSAAAAVTRPQTRRLRIVLIDDHAIVRQGLRFILDREQDMHVVGEASSAAEAMTVVAQQHPDIVLLDLKLSTGSDIEGLEVCSELTRRFPQAGVLVLTTFLDDALVLEAIHRGAKGYVLKDVDTTALVSSIRAVARDESAFDPRSASVMMRTIRTAPEEPTLTDRETKVLELLARGMSNREIGGRLYISETTVKFHVRNIMRKLSASTRAGAVYEASKLGLI GT:EXON 1|1-222:0| BL:SWS:NREP 1 BL:SWS:REP 14->222|DEGU_BACSU|2e-34|37.9|206/229| PROS 176->203|PS00622|HTH_LUXR_1|PDOC00542| BL:PDB:NREP 1 BL:PDB:REP 15->219|3c3wB|2e-27|33.2|202/210| RP:PDB:NREP 1 RP:PDB:REP 15->222|3c3wA|1e-31|37.6|205/211| RP:PFM:NREP 2 RP:PFM:REP 17->132|PF00072|1e-10|30.6|111/111|Response_reg| RP:PFM:REP 161->209|PF00196|2e-07|59.2|49/57|GerE| HM:PFM:NREP 2 HM:PFM:REP 17->131|PF00072|2.8e-26|30.6|111/112|Response_reg| HM:PFM:REP 160->214|PF00196|2.2e-21|50.9|55/58|GerE| GO:PFM:NREP 7 GO:PFM GO:0000156|"GO:two-component response regulator activity"|PF00072|IPR001789| GO:PFM GO:0000160|"GO:two-component signal transduction system (phosphorelay)"|PF00072|IPR001789| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00072|IPR001789| GO:PFM GO:0003700|"GO:transcription factor activity"|PF00196|IPR000792| GO:PFM GO:0005622|"GO:intracellular"|PF00196|IPR000792| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00196|IPR000792| GO:PFM GO:0043565|"GO:sequence-specific DNA binding"|PF00196|IPR000792| RP:SCP:NREP 2 RP:SCP:REP 13->204|1s8nA|2e-21|22.5|187/190|c.23.1.1| RP:SCP:REP 176->222|1fseF|2e-12|27.7|47/50|a.4.6.2| HM:SCP:REP 9->143|1k66A_|7.5e-27|31.1|132/149|c.23.1.1|1/1|CheY-like| HM:SCP:REP 140->222|1p4wA_|2e-21|41.0|83/0|a.4.6.2|1/1|C-terminal effector domain of the bipartite response regulators| OP:NHOMO 4689 OP:NHOMOORG 753 OP:PATTERN -----------------------1------11---1---11111---2---12-1-1111-------- BEG3n85655432475533-38116F333334FBBBFMJK6F9aGQC76EB8788666--ABH6bEQapbC6444B34-331C--11-3312--22---5-7133J4H33-------------------1--1---BEFIG87AL8E68955344---11332564FGEI1-11----1----6863211288C99999CCC7C99CCCEBCC6BADC3638542554555MT444444434444444344433---22-1--1222322221-1-111122232343333333333333222222222222233322222325A39B55556551537222212194532E4431B95771565321261119214112-----18N794256678733333333324-9888AAB84C7-67748789879A432227346657534---------1112A42--111111----------------------1361-54334E67DD98BAA7AAEMGGGG6CCEFDILL-2DFABF965BBCAH46B37846621111111-1577925721363164221-31631472755557444---------------------2--11167355387852777893769A986759888--12422------95675878A97876789-A988878888A7977866666677765A89AA9AAAA9AAAAA878777873-C88888788888--3444444111126D3311111211111-113222222222245EFGEAGBEB99B76CA9---------13457676775A656DDB8C878882222113-442222--------2----------------------------1232222223O- ------------------------------------------------------------------------------------------------------------2----------------------------------------------------------------3-----------3--2-----2---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 222 STR:RPRED 100.0 SQ:SECSTR cEETTEEccccEEcEEEEEEcccHHHHHHHHHHHHTcTTEEEEEEEccHHHHHHHHHHHcccEEEEccEETTEETEEHHHHHHHHHHHcTTcEEEEGGGcccHHHHHHHHHHTcccHHHHHHHHHHHHHHHHHHHHHGGGccHHHHHHHHHHHHHHHTTTTccHHHHHHHHHHHTTccHHHHHHHHTccHHHHHHHHHHHHHHTTcccccHHHHHHHHHTTT DISOP:02AL 1-11, 147-162| PSIPRED ccccccccccccccEEEEEEcccHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHccccEEEEEccccccccccHHHHHHHHHHHcccccEEEEEccccHHHHHHHHHccccEEEcccccHHHHHHHHHHHHcccccccHHHHHHHHHHHccccccccccHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHHHHHHHHccccHHHHHHHHHHcccc //