[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57097.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.38.1
:123 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  63->122 1iq6A  d.38.1.4 * 1e-05 12.1 %
:HMM:SCOP  2->123 2bi0A1 d.38.1.4 * 7.9e-09 25.4 %
:HMM:PFM   34->72 PF05106 * Phage_holin_3 0.00022 15.4 39/100  
:HMM:PFM   85->121 PF02639 * DUF188 0.00096 24.3 37/130  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57097.1 GT:GENE BAD57097.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2427930..2428301 GB:FROM 2427930 GB:TO 2428301 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57097.1 LENGTH 123 SQ:AASEQ MTAPAPVSFGPLTESDFLGHRAAARHPGMLESRVATEEFTVAAAPLAAGLLASFATGWLGADTVRRFRTRCTRALWPGDTLTCSGYVVQRYVEDGEDRVDVALTGLDQEGEVVIRAWASFAAR GT:EXON 1|1-123:0| SEG 42->55|aaaplaagllasfa| HM:PFM:NREP 2 HM:PFM:REP 34->72|PF05106|0.00022|15.4|39/100|Phage_holin_3| HM:PFM:REP 85->121|PF02639|0.00096|24.3|37/130|DUF188| RP:SCP:NREP 1 RP:SCP:REP 63->122|1iq6A|1e-05|12.1|58/132|d.38.1.4| HM:SCP:REP 2->123|2bi0A1|7.9e-09|25.4|122/0|d.38.1.4|1/1|Thioesterase/thiol ester dehydrase-isomerase| OP:NHOMO 4 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- ---------------2------------------1-1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4| PSIPRED cccccccccccccccHHccccHHccccccHHHHHccHHHHHHHHHHHHHHHHHHHHccccHHHEEEEEEEEEEEEccccEEEEEEEEEEEEEccccEEEEEEEEEccccccEEEEEEEccccc //