[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57100.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:232 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57100.1 GT:GENE BAD57100.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2430371..2431069) GB:FROM 2430371 GB:TO 2431069 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57100.1 LENGTH 232 SQ:AASEQ MKYRKSVAALALALAAGTAGAATATAAPSLDVDLAPGVNYRAYQDGAAAVISIDSGSLIVENGKFQIRSADGQVVAGVPLEFNYDDIAFPIDAEIEGNTARLTPVLDMDRARYNPVALPFEDSAPWKTPYEREVAAWTRMTSTVSMAATVGAVVGAVGAGAIGCLLGGVAGTALTGPLATLFGAGPLAGCLIGAGALAPIGALVGSIGVTGPVAIAAFIQYQSTITAPFPAK GT:EXON 1|1-232:0| TM:NTM 3 TM:REGION 7->29| TM:REGION 146->168| TM:REGION 188->210| SEG 8->27|aalalalaagtagaatataa| SEG 147->203|aatvgavvgavgagaigcllggvagtaltgplatlfgagplagcligagalapigal| OP:NHOMO 6 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------5-1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 231-232| PSIPRED ccHHHHHHHHHHHHHHHHHHcccccccccccccccccccEEEEEEccEEEEEEEccEEEEEccEEEEEEccccEEEEccEEEEEccEEcHHHccccccEEEEEEEccHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccc //