[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57103.1
DDBJ      :             putative transporter
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  26/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.94.1
:345 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   42->345 3c9hB PDBj 7e-14 13.8 %
:RPS:SCOP  50->344 1d9vA  c.94.1.1 * 4e-21 19.5 %
:HMM:SCOP  45->346 1xvxA_ c.94.1.1 * 4.6e-32 26.0 %
:RPS:PFM   131->226 PF04258 * Peptidase_A22B 6e-04 39.5 %
:HMM:PFM   63->121 PF01547 * SBP_bac_1 2.2e-06 32.8 58/314  
:HMM:PFM   300->319 PF03681 * UPF0150 0.00027 40.0 20/48  
:HMM:PFM   29->69 PF04748 * Polysacc_deac_2 0.00039 19.5 41/213  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57103.1 GT:GENE BAD57103.1 GT:PRODUCT putative transporter GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2434625..2435662 GB:FROM 2434625 GB:TO 2435662 GB:DIRECTION + GB:PRODUCT putative transporter GB:PROTEIN_ID BAD57103.1 LENGTH 345 SQ:AASEQ MKTLRKAAAAVATLATVAVLAACGGSPSTTAPVDGSWDDVVAAARQEGKVLLYSSQKPANLQVLEKEFEAAYPGIDLEFVRGTDADLNPRVETENRTGRGTADVHMITDATWIAGAAESGRYSTELVGPSLSAPEFRTDTTVLNNRFALTSAAVFALGWNTTAVPEGLSSPRDLLDPRFQGKIGIVNPTGIASYVDLYRHYAQAFGPEYWERLAALKPRIYPSALGVAQALTSGEIIATPSVQPLVTEVAAGAPVDWKLPESPWGTPWYTHALGVAPHPNAAQVLVDFMVTRAGQTALNSGYAAVLPDVPGAVARAEDISMPDTADLSPQLVGEYSQQWARLFQS GT:EXON 1|1-345:0| SEG 7->22|aaaavatlatvavlaa| RP:PDB:NREP 1 RP:PDB:REP 42->345|3c9hB|7e-14|13.8|304/339| RP:PFM:NREP 1 RP:PFM:REP 131->226|PF04258|6e-04|39.5|86/286|Peptidase_A22B| HM:PFM:NREP 3 HM:PFM:REP 63->121|PF01547|2.2e-06|32.8|58/314|SBP_bac_1| HM:PFM:REP 300->319|PF03681|0.00027|40.0|20/48|UPF0150| HM:PFM:REP 29->69|PF04748|0.00039|19.5|41/213|Polysacc_deac_2| GO:PFM:NREP 2 GO:PFM GO:0004190|"GO:aspartic-type endopeptidase activity"|PF04258|IPR007369| GO:PFM GO:0016021|"GO:integral to membrane"|PF04258|IPR007369| RP:SCP:NREP 1 RP:SCP:REP 50->344|1d9vA|4e-21|19.5|287/309|c.94.1.1| HM:SCP:REP 45->346|1xvxA_|4.6e-32|26.0|292/0|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 29 OP:NHOMOORG 26 OP:PATTERN -------------------------------------------------------------------- -------1111-------------------------1-13---1----------------------1---1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------2----11---1-1-11-------------1----------------1------------------------------------1-1-------------------------------------------------------------------------1------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------1------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 305 STR:RPRED 88.4 SQ:SECSTR ########################################ETccTTcEEEEEEEcccHHHHHHHHHHHHHHcTTEEEEEEEccHHHHHHHHHHHHHTTcccccEEEEccHHHHHHHHHTTcccTTGGGccGGGEETTTEEEcccEEEEEEEEGGGcccccccccHHHHHHHHHHTHHHHTTcEEEEcTcHHHHHHHHHHHHHcTTHHHHHHHHHHTTcEEEccHHHHHHHHHTTcccEEEEEEHHHHHHHHTTcTTEEEEcccccEEEEccEEEEcccHHHHHHHHHHHHcHHHHHHHHcccccccTTcHHHHHGGGEEEcccTTGGGGcccHHHHHHHHHHHHH DISOP:02AL 1-4| PSIPRED ccHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHcccEEEEEEcccHHHHHHHHHHHHHHccccEEEEEEcccHHHHHHHHHHHHcccccccEEEEccHHHHHHHHHHHHHHHHccccccccHHHcccccccccEEEEEEEEEEEEEEEHHHcccccccHHHHccHHHccEEEEEcccHHHHHHHHHHHHHHHccHHHHHHHHHcccEEEcccHHHHHHHHcccEEEEEHHHHHHHHHHccccEEEEEEccccEEEEEEEHHcccccHHHHHHHHHHHccHHHHHHHHHccccccccccHHHcccccccccHHccccHHHHHHHHHHHHHHHcc //