[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57108.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  21/68 : Bacteria  89/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.157.1
:353 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   26->111 1smlA PDBj 2e-06 29.8 %
:BLT:PDB   161->323 2zo4A PDBj 2e-17 40.1 %
:RPS:PDB   11->247 2bfkA PDBj 3e-14 17.4 %
:RPS:SCOP  24->329 1qh3A  d.157.1.2 * 9e-19 16.9 %
:HMM:SCOP  1->281 1smlA_ d.157.1.1 * 1e-33 32.4 %
:HMM:PFM   29->233 PF00753 * Lactamase_B 1e-24 29.9 157/194  
:HMM:PFM   236->274 PF06253 * MTTB 0.00091 26.3 38/505  
:BLT:SWISS 26->111 BLA1_STEMA 5e-06 29.8 %
:BLT:SWISS 157->244 YCBL_ECOLI 3e-09 37.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57108.1 GT:GENE BAD57108.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2440103..2441164) GB:FROM 2440103 GB:TO 2441164 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57108.1 LENGTH 353 SQ:AASEQ MSGEWTEPGCHPVADGVHRVPLTLPQDGLRAVNVYVLETDAGLAMIDGGWHRPHTHTELAAGLARIGRRPAEIHDVFVTHIHRDHYTFALELRRRYGTRVHLGADEAPGLAAVRALGSNVPESSLRELRRAGAPELAAAAYAASAAEPFDRADWAAPDHWLRPGPLPLAGHDLRVLATPGHTKGHLVFHDRRRGLLYTGDHLLPTITPSIGFELGEWDLPLGRFLDSLRACADATAIMLPAHGPTGGSAGARAADLLAHHEQRFTEIAAVLADLGPATGFAVARGLTWTRRGRRFTELDTFNRMIAVCETMAHLDVLVARGVVRREPRDGVELFRPVQAQVHPPSTYSSAPVR GT:EXON 1|1-353:0| BL:SWS:NREP 2 BL:SWS:REP 26->111|BLA1_STEMA|5e-06|29.8|84/290| BL:SWS:REP 157->244|YCBL_ECOLI|3e-09|37.9|87/215| SEG 125->147|lrelrragapelaaaayaasaae| BL:PDB:NREP 2 BL:PDB:REP 26->111|1smlA|2e-06|29.8|84/266| BL:PDB:REP 161->323|2zo4A|2e-17|40.1|147/301| RP:PDB:NREP 1 RP:PDB:REP 11->247|2bfkA|3e-14|17.4|195/220| HM:PFM:NREP 2 HM:PFM:REP 29->233|PF00753|1e-24|29.9|157/194|Lactamase_B| HM:PFM:REP 236->274|PF06253|0.00091|26.3|38/505|MTTB| RP:SCP:NREP 1 RP:SCP:REP 24->329|1qh3A|9e-19|16.9|249/260|d.157.1.2| HM:SCP:REP 1->281|1smlA_|1e-33|32.4|244/266|d.157.1.1|1/1|Metallo-hydrolase/oxidoreductase| OP:NHOMO 136 OP:NHOMOORG 110 OP:PATTERN 22-----122222211--1111-2----1-1------------------------------111---- ----1-------------------------------1243-312--------1----1----1-1121-1---------1311-----------------------------------------------------11111---1---------------------------------------1111----1--------------------------11-1---------1-------------------------------------------------------------------------------------------1----------------------1------1-33---1-1-------1----1--1--------------------------------------------------------1--------------------------11-------------------------------1-1-----11111111111111--11111111------1---------11-1--------------------11--112------------1-------1111--1------------------------------------------------------------------------------------------------------------------------------------------------------------------------11----------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 330 STR:RPRED 93.5 SQ:SECSTR EEEcccccEEEEccccEEEEEEEEEcccEEEEEEEEEEETTEEEEEcccccHHHHHHHHHHHHHHHHHHTccEEEEEcccccHHHHHTTHHHHHHTTcEEEccHHHHHHHHHTTcccccccccEccTTcEEEETTEEEEEEHHHHTHHHHTTccccccccccEEEEEETTEEEEEEccccccccccEEEETTTTEEEEETTcccTTcccccccccccHHHHHHHHHHHHHHcccccEEEEcccccccTHHHHHHHHHHHHHHHHHTHHHHHHHTTcEEEEcHHHHHHHHHHHHTcccccccccHHHHTTccGGGEEEEEHHHHHHHHHcc####################### DISOP:02AL 346-353| PSIPRED ccccccccccEEEcccEEEEEEEccccccccEEEEEEEcccEEEEEEcccccHHHHHHHHHHHHHHccccccEEEEEEEcccccHHHHHHHHHHHcccEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHcccccccccccccEEEcccEEEEccEEEEEEEccccccccEEEEEccccEEEEEEEEEcccccccccccccHHHHHHHHHHHHHHHccccEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHccEEEEEEcccEEEEEEEEEEEEccccccccccc //