[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57111.1
DDBJ      :             putative acyl-CoA synthetase
Swiss-Prot:             

Homologs  Archaea  36/68 : Bacteria  596/915 : Eukaryota  140/199 : Viruses  0/175   --->[See Alignment]
e.23.1
:503 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   147->482 1mdbA PDBj 7e-27 28.1 %
:RPS:PDB   8->489 3e7wA PDBj 5e-30 14.2 %
:RPS:SCOP  8->482 1md9A  e.23.1.1 * 4e-41 24.1 %
:HMM:SCOP  3->492 1pg4A_ e.23.1.1 * 1.6e-94 30.1 %
:RPS:PFM   147->409 PF00501 * AMP-binding 9e-22 32.2 %
:HMM:PFM   30->420 PF00501 * AMP-binding 3.4e-63 25.4 390/418  
:BLT:SWISS 147->491 FADK_ECOLI 5e-28 27.9 %
:PROS 149->160|PS00455|AMP_BINDING
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57111.1 GT:GENE BAD57111.1 GT:PRODUCT putative acyl-CoA synthetase GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2442237..2443748) GB:FROM 2442237 GB:TO 2443748 GB:DIRECTION - GB:PRODUCT putative acyl-CoA synthetase GB:PROTEIN_ID BAD57111.1 LENGTH 503 SQ:AASEQ MKVLAKELIERCRQAPGTLAVIDEHGAHTLAEIVTAAEELASRLAEIDTRAPTVLVQADNTWRTVAAALAVGLRGGVVAVFSPHASAAEFRLAVEDIDPDVVVGDVATLAHWEVPESGFPVRASGFDTVSVRAKPGFGDVTRWRGGAAIAMTSGSTGRPKCVVQSEEAIRYACDRTIEAVGLRAGEGVGAFVPLSSVAAFCFGLYLPAHLGGHMVCVGRWSPAAALAAMHERRVAWTMLVPTMALQLSVVDDAAGKLGALRAMTVGGGPMNERALAEAESVLGTTFLRVFGMSECLGHTTPRPDDPPAIRLGRDGRPFPGTVVRAVGGDGKPLPPGEIGDAQVKGPSLFVGYARHGVPVPPELTPDGFLPTGDLVEVAADGSIRVMGRQKQIIIRGGRNIDINEMEAALAALPGVVQVCVVPVPDDLLGERAAALIVTGGAPLTLSEVTERLAVAGVPKAKWPEYVFTVPDLPQNRVGKLSRPDAVRLATQLATLDPSSSQVR GT:EXON 1|1-503:0| BL:SWS:NREP 1 BL:SWS:REP 147->491|FADK_ECOLI|5e-28|27.9|344/548| PROS 149->160|PS00455|AMP_BINDING|PDOC00427| TM:NTM 2 TM:REGION 186->208| TM:REGION 234->256| SEG 65->80|vaaalavglrggvvav| SEG 392->403|iiirggrnidin| SEG 413->424|pgvvqvcvvpvp| BL:PDB:NREP 1 BL:PDB:REP 147->482|1mdbA|7e-27|28.1|335/536| RP:PDB:NREP 1 RP:PDB:REP 8->489|3e7wA|5e-30|14.2|479/508| RP:PFM:NREP 1 RP:PFM:REP 147->409|PF00501|9e-22|32.2|261/405|AMP-binding| HM:PFM:NREP 1 HM:PFM:REP 30->420|PF00501|3.4e-63|25.4|390/418|AMP-binding| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF00501|IPR000873| GO:PFM GO:0008152|"GO:metabolic process"|PF00501|IPR000873| RP:SCP:NREP 1 RP:SCP:REP 8->482|1md9A|4e-41|24.1|474/536|e.23.1.1| HM:SCP:REP 3->492|1pg4A_|1.6e-94|30.1|489/643|e.23.1.1|1/1|Acetyl-CoA synthetase-like| OP:NHOMO 3906 OP:NHOMOORG 772 OP:PATTERN ------4575565753--2----932221-332-1---1111131224-1212--------1------ -264I233222745EWGCC-CN44OSCCCCCDNQWQJbpl1Q5S11-1142-325332--HDA-KENFCL52111----2547--1--1131-2--1-------1--11----------------1--1-111---7778A---A41--222211-----1-----4216-------------33244---C56AAAAA8894A9B98845AA669966CA783211111192111111111111111111111-1-11---------11---113--------1-------------------------------------11---11111111---3-22------3--51-4-752131--731111-1-4--9669-----24LHJ325JEOHG22222222224-86887A7968A-5116236337648955588B344464C--------6---1683------------------------------78O8-4CB6E8CDHG9A777699CGBBBB6CL7NQTZP12B9969875I69EIJ117---25122222222127442K9-2332333332-2432411244444G624-1-------------------1-12--23-452322213333325344433441336--11512------33541224445455543-345444545545544444343522761423344444443433422334433--222222122121---2-----111124723111111-11--11113334312235617889EC6C585676535-11111111-1224333332213322222223331111--1---11-------------------------------------------------2- ----42------33537755222546B554435134553444534432334265443136451--1--1-1---------------11-6147331-1--1-2414-1517351-22----141----15C2-1231---2---2-1-1--1-2-111512-552525389235D1132K22442947F5892384835 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 491 STR:RPRED 97.6 SQ:SECSTR cccHHHHHHHHHHHcTTcEEEEETTEEEEHHHHHHHHHHHHHHHTTTccccccEEEEEcccHHHHHHHHHHHHHTccEEEEETTccHHHHHHHHHHHTccEEEEccccHHcTTcccccccEEEHHHHHTcccccccGGGcccTTcEEEEEEEccTTcccEEEEEEHHHHHHHHHHHHHHcTTTTTcEEEEcccTTcTHHHHHHHHHHHTTcEEEEcHHHHcHHHHHHHHHHHcccEEEEcHHHHHHHHTcTTccTTTcTTccEEEEccccccHHHHHHHHcTTcEEEEccccGGGccccEEEEEcHHHHTTccccEEcTTcEEEEEcTTcccccTTccEEEEEEcTTcccccTTcHHHHHHHEEcccEEEEEEEEEEEETTEEEEEEEcccEEEETTEEEEHHHHHHHHHHcTTEEEEEEEEEcccccccEEEEEEccccHHHHHHHHHHHHHHHHccGGGcccEEEEcccccccTTccccHHHHHHHHcc############ DISOP:02AL 491-503| PSIPRED cccHHHHHHHHHHHccccEEEEEcccEEcHHHHHHHHHHHHHHHHHccccccEEEEEccccHHHHHHHHHHHHHccEEEEccccccHHHHHHHHHHcccEEEEEcHHHHHHHHHHcccccEEEcccHHHHcccccccccccccccEEEEEEccccccccccEEEcHHHHHHHHHHHHHHHccccccEEEEEccHHHHHHHHHHHHHHHHHccEEEEcccccHHHHHHHHHHccccEEEccHHHHHHHHHcccccccccccEEEEEEcccccHHHHHHHHHHcccEEEEccccHHHHHHEEEcccccHHHccccccEEccccEEEEEcccccccccccEEEEEEcccHHHHHHcccHHHHHHHHHccccEEEccEEEEccccEEEEEEccccEEEEccEEEcHHHHHHHHHHcccEEEEEEEEccccccccEEEEEEEcccccccHHHHHHHHHHHcccccccccEEEEEEcccccccccccHHHHHHHHHHHHcccccccccc //