[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57118.1
DDBJ      :             putative lipid-transfer protein
Swiss-Prot:             

Homologs  Archaea  51/68 : Bacteria  134/915 : Eukaryota  123/199 : Viruses  0/175   --->[See Alignment]
c.95.1
:383 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   192->381 2c7yA PDBj 2e-10 20.3 %
:RPS:SCOP  271->356 1afwA2  c.95.1.1 * 7e-06 23.5 %
:HMM:SCOP  4->223 1ulqA1 c.95.1.1 * 5.8e-36 30.0 %
:HMM:SCOP  261->382 1afwA2 c.95.1.1 * 5.7e-19 31.2 %
:RPS:PFM   270->356 PF02803 * Thiolase_C 4e-05 35.1 %
:HMM:PFM   260->354 PF02803 * Thiolase_C 6.2e-10 27.3 77/123  
:HMM:PFM   46->107 PF00109 * ketoacyl-synt 1.9e-06 37.7 61/253  
:BLT:SWISS 5->380 NLTP_HUMAN 6e-34 29.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57118.1 GT:GENE BAD57118.1 GT:PRODUCT putative lipid-transfer protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2449767..2450918) GB:FROM 2449767 GB:TO 2450918 GB:DIRECTION - GB:PRODUCT putative lipid-transfer protein GB:PROTEIN_ID BAD57118.1 LENGTH 383 SQ:AASEQ MNQPVSIIGVGLSKFGRQPGVSGRQMAITAIGAALADAGVTWPDVQVAFGGSDGSGLADTLVADLGLTGIPFTNVKNGCATGGSALFSAVNAIRAGAADIALAVGFDKHPRGAFDPAPAEWGLPEGYGSEGLMVTTQFFGAKINRYMRRHGISAATLAAVAEKAYRNGALNPNAWRREPIPAARIAAAEMVNDPLTKFMFCSPGEGGAAVIVASPAVARRLGARAVQLRAISHRTRRFGSFEVFSPAVQGSGEPTSVSADAAGAAFEQAGIDPHEVDVAQVQDTESGAEIMHMAECGFCEHGEQEKWIAAGDTEIGGRLPVNTDGGCLANGEPIGASGLRQVHEIVTQLRGEAGARQVPGTPRVGFTHVYGAPGISACTVLAV GT:EXON 1|1-383:0| BL:SWS:NREP 1 BL:SWS:REP 5->380|NLTP_HUMAN|6e-34|29.6|368/547| SEG 27->39|aitaigaaladag| SEG 89->105|avnairagaadialavg| SEG 176->189|rrepipaariaaae| SEG 259->269|adaagaafeqa| RP:PDB:NREP 1 RP:PDB:REP 192->381|2c7yA|2e-10|20.3|153/391| RP:PFM:NREP 1 RP:PFM:REP 270->356|PF02803|4e-05|35.1|77/131|Thiolase_C| HM:PFM:NREP 2 HM:PFM:REP 260->354|PF02803|6.2e-10|27.3|77/123|Thiolase_C| HM:PFM:REP 46->107|PF00109|1.9e-06|37.7|61/253|ketoacyl-synt| GO:PFM:NREP 2 GO:PFM GO:0008152|"GO:metabolic process"|PF02803|IPR002155| GO:PFM GO:0016747|"GO:transferase activity, transferring acyl groups other than amino-acyl groups"|PF02803|IPR002155| RP:SCP:NREP 1 RP:SCP:REP 271->356|1afwA2|7e-06|23.5|68/124|c.95.1.1| HM:SCP:REP 4->223|1ulqA1|5.8e-36|30.0|220/0|c.95.1.1|1/1|Thiolase-like| HM:SCP:REP 261->382|1afwA2|5.7e-19|31.2|96/124|c.95.1.1|2/2|Thiolase-like| OP:NHOMO 768 OP:NHOMOORG 308 OP:PATTERN 111--134444444231-4121-831113135111--------111111111111111---233--22 --1-5--1------8L955-59--76555555E8E84B8C-B19--------111--1--226--214-5-------------------------------------------------------------------1111---1----------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------1-----------6222-------3351-144652--------------1--3-1116--111-----1--13--1--1-----1---------1-------------------------------------31B3--B636-1122------1121------1-919BB-----11-111-3247--1----------------5---D25------------1--1-1--------1----------------------------------1--2-------11------1-------------------------------------------------------------------------------------------------------------------------------------------------1111121------1---------------------------------------------22--11------------------------------------------------- ------1-211----222321112122111111111221212211111121111-11111111--------------------------1212111----1-1111-2-1111111-121111211-3-3A2-3121111--2112-1-11122111123241121121121131--------------1--------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 264 STR:RPRED 68.9 SQ:SECSTR #########################################################################################################HHHHcTTHHHHHHHHHHTccccEEccccGGGHHHHHHHHHHHHHTTcccEEEEEEEEccccH##HHHHHHHHTTcccccccHHHcTTcccccccccccEEEEEEEEEEEHHHHHHHTcccEEEEEEEEEEccEEEEEcccGGGTTcHHHHHHHHHHHHTHHHHHTccGGGccEEEEccccHHHHHHHHHHHTccGGGGG##########EEGGGGccTTccHHHHcccGGGHHHHHHHHHHHHHHHHcTTHcTTccccEEEEEEEccTTEEEEEEE## DISOP:02AL 383-384| PSIPRED ccccEEEEEEEEccccccccccHHHHHHHHHHHHHHHccccHHHccEEEEEcccccHHHHHHHHHcccccEEEEEccccHHHHHHHHHHHHHHHcccccEEEEEEEccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccccccccHHHHcccccccccccHHHccccccccEEEEEEcHHHHHHcccccEEEEEEEEEEccccccccccccccccccccccHHHHHHHHHHHHcccHHHEEEEEEcccHHHHHHHHHHHccccccccHHHHHHcccccccccccccccccHHHHccHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEEccccHHHEEEEEEc //