[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57119.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  16/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.40.4
:117 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  1->82 2gnrA1  b.40.4.15 * 1e-05 19.7 %
:HMM:PFM   36->101 PF01796 * DUF35 1.9e-14 40.7 59/68  
:HMM:PFM   2->29 PF12172 * DUF35_N 2.6e-05 39.3 28/37  
:BLT:SWISS 6->82 Y1552_METJA 5e-07 38.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57119.1 GT:GENE BAD57119.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2450923..2451276) GB:FROM 2450923 GB:TO 2451276 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57119.1 LENGTH 117 SQ:AASEQ MDEPVLEGSECGVCGTVGFPASTMCARCATPTARPRPLSRDGVVWAYTVQRFPPKSPPYVAPAEGFSPYAVGWVELPDGIRVEALLDGGADTDLDRAPVRLVAASPVPRFAVIGEEV GT:EXON 1|1-117:0| BL:SWS:NREP 1 BL:SWS:REP 6->82|Y1552_METJA|5e-07|38.0|71/141| SEG 84->95|alldggadtdld| HM:PFM:NREP 2 HM:PFM:REP 36->101|PF01796|1.9e-14|40.7|59/68|DUF35| HM:PFM:REP 2->29|PF12172|2.6e-05|39.3|28/37|DUF35_N| RP:SCP:NREP 1 RP:SCP:REP 1->82|2gnrA1|1e-05|19.7|76/137|b.40.4.15| OP:NHOMO 18 OP:NHOMOORG 16 OP:PATTERN -------------------------------------------------------------------- ---------------11----1---1------11111-11---2------------------2--11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED ccccEEEEEEEccccEEEEccHHHccccccccEEEEEcccccEEEEEEEEEEccccccccccccccccEEEEEEEcccccEEEEEEccccccccEEccEEEEccccccEEEEEEccc //