[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57122.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.17.4
:127 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   4->111 1dmmA PDBj 4e-09 19.8 %
:RPS:SCOP  5->110 2bngA1  d.17.4.8 * 2e-08 23.3 %
:HMM:SCOP  1->118 2a15A1 d.17.4.3 * 2.1e-10 27.1 %
:RPS:PFM   5->84 PF02136 * NTF2 2e-04 32.1 %
:HMM:PFM   4->29 PF02136 * NTF2 0.00046 30.8 26/118  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57122.1 GT:GENE BAD57122.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2453452..2453835 GB:FROM 2453452 GB:TO 2453835 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57122.1 LENGTH 127 SQ:AASEQ MATAIEDYYATVDSGRLAEATAMLADDVEFAMVLPNGINLGRGRAAMLDYLAGRPPVDRRHRVLRVAADGDTMFAYGEVTEQGGRVTTGHFVGAMHVGADGLIDRYQVSFSADFALVPDRPTRSSPR GT:EXON 1|1-127:0| RP:PDB:NREP 1 RP:PDB:REP 4->111|1dmmA|4e-09|19.8|106/123| RP:PFM:NREP 1 RP:PFM:REP 5->84|PF02136|2e-04|32.1|78/115|NTF2| HM:PFM:NREP 1 HM:PFM:REP 4->29|PF02136|0.00046|30.8|26/118|NTF2| GO:PFM:NREP 2 GO:PFM GO:0005622|"GO:intracellular"|PF02136|IPR002075| GO:PFM GO:0006810|"GO:transport"|PF02136|IPR002075| RP:SCP:NREP 1 RP:SCP:REP 5->110|2bngA1|2e-08|23.3|103/132|d.17.4.8| HM:SCP:REP 1->118|2a15A1|2.1e-10|27.1|118/0|d.17.4.3|1/1|NTF2-like| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-11---1----------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 121 STR:RPRED 95.3 SQ:SECSTR HHHHHHHHHHHHHHTcHHHHHTTEEEEEEEEccTcTTcccEEHHHHHHHHHHHHcccEEEEccccEEccccEEEEEEEEEEETTEEEEEEEEEEEEEcTTccEEEEEEEccGGHHHHHHHH###### DISOP:02AL 122-127| PSIPRED ccccccccEEEccccccHHHHHHHHcccEEEEEccccccccccHHHHHHHHccccccccccEEEEEEEcccEEEEEccEEccccEEEEcEEEEEEEEccccccEEEEEEEcccEEEEcccccccccc //