[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57123.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  6/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.17.4
:124 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   2->112 3dxoB PDBj 4e-05 15.2 %
:RPS:SCOP  1->111 1ocvA  d.17.4.3 * 7e-05 14.7 %
:HMM:SCOP  1->114 2a15A1 d.17.4.3 * 2e-05 15.9 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57123.1 GT:GENE BAD57123.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2453832..2454206 GB:FROM 2453832 GB:TO 2454206 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57123.1 LENGTH 124 SQ:AASEQ MTTTATPVLARWFEYMDSDDPDRVLTMITDDFVMSVQFSRGGGASTEFVGDRAALIGYLAQREKSTLVHHLDAGAVVDGHELVLGRTTRDGAFEASFNASAQVDADGRVRRLLIARTPELSFAR GT:EXON 1|1-124:0| RP:PDB:NREP 1 RP:PDB:REP 2->112|3dxoB|4e-05|15.2|105/115| RP:SCP:NREP 1 RP:SCP:REP 1->111|1ocvA|7e-05|14.7|109/125|d.17.4.3| HM:SCP:REP 1->114|2a15A1|2e-05|15.9|113/0|d.17.4.3|1/1|NTF2-like| OP:NHOMO 6 OP:NHOMOORG 6 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-11---1---------------------11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 112 STR:RPRED 90.3 SQ:SECSTR cHHHHHHHHHHHHcccHHHHHHHHHHHEEEEEEEEccccEcccEEEHHHHHHHHHHHHHHHcTTcEEEEEEEEEEETTEEEEEEEEEcTTccEEEEEEEEEEEcTTccEEEE############ DISOP:02AL 1-2| PSIPRED cccccHHHHHHHHHHHccccHHHEEEEEEccEEEEEEEcccccccccccccHHHHHHHHHHHHHHHHHEEcccccEEcccEEEEEcccccccEEEcccccEEEcccccEEEEEEEEcccccccc //