[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57124.1
DDBJ      :             putative transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  12/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.6.1
:247 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   126->195 3gp4B PDBj 2e-06 31.4 %
:RPS:PDB   127->209 3d71A PDBj 1e-15 15.2 %
:RPS:SCOP  9->44 1j9iA  a.6.1.5 * 1e-04 16.7 %
:RPS:SCOP  127->200 1q05A  a.6.1.3 * 3e-13 25.7 %
:HMM:SCOP  8->115 1jbgA_ a.6.1.3 * 5.4e-11 26.9 %
:HMM:SCOP  126->232 1jbgA_ a.6.1.3 * 2.1e-18 30.1 %
:HMM:PFM   14->47 PF00376 * MerR 4e-10 44.1 34/38  
:HMM:PFM   128->163 PF00376 * MerR 6.3e-12 50.0 36/38  
:HMM:PFM   172->230 PF09278 * MerR-DNA-bind 0.00012 28.8 59/65  
:HMM:PFM   55->115 PF11740 * KfrA_N 7.1e-05 29.5 61/120  
:BLT:SWISS 127->191 HMMR_RHILV 2e-07 35.4 %
:COIL
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57124.1 GT:GENE BAD57124.1 GT:PRODUCT putative transcriptional regulator GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2454190..2454933) GB:FROM 2454190 GB:TO 2454933 GB:DIRECTION - GB:PRODUCT putative transcriptional regulator GB:PROTEIN_ID BAD57124.1 LENGTH 247 SQ:AASEQ MESRNSGPMRTVTVARRSGYSVQQIRNLEGDGVLPPAARTDSGYRVYDDRHVRAARAYRALAAAVGPVEAKTIMRAVHAAPVAEALARLDAAHADLDRQRRDLRAAEAAAHAIADEPLTAVRPADAMTVSELADALGIRASTLRHWDAEGLVVPERAGGARRYSPTDVRDARIVHQLRRAGHRIDDLRTLLPHFRGARRHEVLAALAARGETLTRRSRALLTAAAELDGLLAEADPAAGPGRLTARS GT:EXON 1|1-247:0| BL:SWS:NREP 1 BL:SWS:REP 127->191|HMMR_RHILV|2e-07|35.4|65/129| COIL:NAA 25 COIL:NSEG 1 COIL:REGION 85->109| SEG 45->64|rvyddrhvraarayralaaa| SEG 76->118|avhaapvaealarldaahadldrqrrdlraaeaaahaiadepl| SEG 212->240|tltrrsralltaaaeldgllaeadpaagp| BL:PDB:NREP 1 BL:PDB:REP 126->195|3gp4B|2e-06|31.4|70/130| RP:PDB:NREP 1 RP:PDB:REP 127->209|3d71A|1e-15|15.2|79/277| HM:PFM:NREP 4 HM:PFM:REP 14->47|PF00376|4e-10|44.1|34/38|MerR| HM:PFM:REP 128->163|PF00376|6.3e-12|50.0|36/38|MerR| HM:PFM:REP 172->230|PF09278|0.00012|28.8|59/65|MerR-DNA-bind| HM:PFM:REP 55->115|PF11740|7.1e-05|29.5|61/120|KfrA_N| RP:SCP:NREP 2 RP:SCP:REP 9->44|1j9iA|1e-04|16.7|36/68|a.6.1.5| RP:SCP:REP 127->200|1q05A|3e-13|25.7|74/122|a.6.1.3| HM:SCP:REP 8->115|1jbgA_|5.4e-11|26.9|104/106|a.6.1.3|1/2|Putative DNA-binding domain| HM:SCP:REP 126->232|1jbgA_|2.1e-18|30.1|103/106|a.6.1.3|2/2|Putative DNA-binding domain| OP:NHOMO 13 OP:NHOMOORG 12 OP:PATTERN -------------------------------------------------------------------- ------------------------------------2111-----1--------------11--1-1111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 126 STR:RPRED 51.0 SQ:SECSTR ########EEHHHHHHHHTccHHHHHHHHHTTccccEEcTTTcc###########################################################################HHTTcccEEHHHHHHHHTccHHHHHHHHHTTcccccTTTccEEEcTTGGGHHHHHHHHHHTTccHHHHHHHTTccHTccHHHHHHHHHHH###################################### DISOP:02AL 1-7, 108-126, 244-247| PSIPRED ccccccccccHHHHHHHHcccHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHccccHHHHHHHHHHcccccccccccEEccHHHHHHHHHHHHHHHccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccc //