[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57126.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  97/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.66.1
:269 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   50->173 3dmfA PDBj 2e-08 30.9 %
:RPS:PDB   27->250 3bgvB PDBj 1e-13 11.0 %
:RPS:SCOP  44->159 2i6gA1  c.66.1.44 * 6e-12 21.9 %
:HMM:SCOP  10->267 1wznA1 c.66.1.43 * 5e-33 24.2 %
:RPS:PFM   58->153 PF08241 * Methyltransf_11 2e-08 41.8 %
:HMM:PFM   58->151 PF08242 * Methyltransf_12 5.7e-14 26.9 93/99  
:BLT:SWISS 22->154 UBIG_XANAC 8e-11 32.6 %
:BLT:SWISS 158->223 Y4607_MYCA9 3e-05 37.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57126.1 GT:GENE BAD57126.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2455501..2456310) GB:FROM 2455501 GB:TO 2456310 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57126.1 LENGTH 269 SQ:AASEQ MTDLDYLTVNKALWDERVPVHLDSEFYDLDGFLAGAEALRPFELAEVGDVGGADLVHLQCHFGLDTLAWARHGARVTGLDFSAPAIEAARRIADSAGLSARFVTADVYSAVDELAATYDIVYTGIGALCWLPDITRWARVVAALLRPGGFLYLAEFHPFTDVLDDATGTTVTLDYFAEGPEVWDEPDAGTYADRSASLRNTTSVEFRHGLGEILTALAAAGLRLEFLHEHDHTLFPRFEALERHGIEYRFPPGRARVPLMYSLKATRQR GT:EXON 1|1-269:0| BL:SWS:NREP 2 BL:SWS:REP 22->154|UBIG_XANAC|8e-11|32.6|132/239| BL:SWS:REP 158->223|Y4607_MYCA9|3e-05|37.1|62/305| BL:PDB:NREP 1 BL:PDB:REP 50->173|3dmfA|2e-08|30.9|123/371| RP:PDB:NREP 1 RP:PDB:REP 27->250|3bgvB|1e-13|11.0|218/271| RP:PFM:NREP 1 RP:PFM:REP 58->153|PF08241|2e-08|41.8|91/96|Methyltransf_11| HM:PFM:NREP 1 HM:PFM:REP 58->151|PF08242|5.7e-14|26.9|93/99|Methyltransf_12| GO:PFM:NREP 2 GO:PFM GO:0008152|"GO:metabolic process"|PF08241|IPR013216| GO:PFM GO:0008168|"GO:methyltransferase activity"|PF08241|IPR013216| RP:SCP:NREP 1 RP:SCP:REP 44->159|2i6gA1|6e-12|21.9|114/177|c.66.1.44| HM:SCP:REP 10->267|1wznA1|5e-33|24.2|236/0|c.66.1.43|1/1|S-adenosyl-L-methionine-dependent methyltransferases| OP:NHOMO 109 OP:NHOMOORG 97 OP:PATTERN -------------------------------------------------------------------- ----1-------------------12-----1----1211-132--2------1------211--11--11-----------1----------------1------------------------------------11111-----1-----------------------------------------------11111111-111--1------111-------------1--------------------------1----------------------------11-------------------------------------11---------------111-----------------------------------------------------------------------1--1-2-----------------------------------------1-----------------------------------------1111----------------1-----------------------1-------------------------------------------------1----------------------------------------1111111111111111111----------------1--------------------------------------1-------------------------------------------------------------------------------------22121111-111-------------------------------2-1-------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 268 STR:RPRED 99.6 SQ:SECSTR ccEEEEEEEccccEEEEEETTEEEEEHHHHHHHHcHHHHHHHHHHHHHTccccEEEEETcTTTTTHHHHHHTccEEEEEEccHHHHHHHHHHHHHHHTcTTcccccEEEEEEccTTTccGEccGGGGGGcHHHHHHHHHHHHTTEEEEEEEEEEEEcHHHHHHHHHHccccEEEcccEEEEEcccccccccccEEEEEEccEEEEEcccHHHHHHHGGGGTEEEEEEEEEEEEEHHHHHHHHTTcHHHHHHHHHcccccccEEEEEEc# DISOP:02AL 269-270| PSIPRED cccccHHHHHHHHHHHHHHHHHHcccccHHHHcccHHHccHHHHHHcccccccEEEEEcccccHHHHHHHHcccEEEEEEccHHHHHHHHHHHHHcccccEEEEccHHHccccccccccEEEEEHHHHHccccHHHHHHHHHHHccccEEEEEEEcccHHHHHccccccEEEcccccccccccccccccHHHcccccccccccEEEEccHHHHHHHHHHcccEEEEEEcccccccHHHHccHHHHHHHccccccccccEEEEEEEEccc //