[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57130.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:142 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   94->138 PF10003 * DUF2244 0.00013 35.6 45/140  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57130.1 GT:GENE BAD57130.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2460686..2461114 GB:FROM 2460686 GB:TO 2461114 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57130.1 LENGTH 142 SQ:AASEQ MSTMIGRNEPMSTVTTAPDTALLCTALRVDGWGTGVFGAVLLAGAAALRDPLGVPTGLSLGFGVVMLAGALALVLLGGRARQAVRHGRTVVLVNSASAVGMVVLACARVLDLTGLGVAFLLSGAAIVATFAAAEYAGLRRAR GT:EXON 1|1-142:0| TM:NTM 4 TM:REGION 28->50| TM:REGION 56->78| TM:REGION 86->108| TM:REGION 115->137| SEG 35->48|gvfgavllagaaal| SEG 60->78|lgfgvvmlagalalvllgg| HM:PFM:NREP 1 HM:PFM:REP 94->138|PF10003|0.00013|35.6|45/140|DUF2244| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7, 141-142| PSIPRED cccccccccccccccccccHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHccHHHHHHHcccEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //