[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57131.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.17.4
:138 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   41->133 3cu3A PDBj 8e-05 27.8 %
:HMM:SCOP  1->137 1hkxA_ d.17.4.7 * 1e-15 28.2 %
:HMM:PFM   3->100 PF00106 * adh_short 0.00017 25.9 85/167  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57131.1 GT:GENE BAD57131.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2461129..2461545 GB:FROM 2461129 GB:TO 2461545 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57131.1 LENGTH 138 SQ:AASEQ MTTTDTTDRAALHALLRAQSAAWAAGDGAAFAATFTPDAVFVSVIGEHIQGSAELARVMQEGFDGFMRDTRLSEPERTTIGFPAPDVAVVVTSGVCVLRGGATTGDPADRSIQTRTAVRSGGRWLFASFQNTRIRQAP GT:EXON 1|1-138:0| SEG 14->39|allraqsaawaagdgaafaatftpda| BL:PDB:NREP 1 BL:PDB:REP 41->133|3cu3A|8e-05|27.8|90/160| HM:PFM:NREP 1 HM:PFM:REP 3->100|PF00106|0.00017|25.9|85/167|adh_short| HM:SCP:REP 1->137|1hkxA_|1e-15|28.2|131/0|d.17.4.7|1/1|NTF2-like| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1---------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 90 STR:RPRED 65.2 SQ:SECSTR ########################################EEcTTccEEEHHHHHHHHHHHHHHTTTTTcEE#EEEEEEEEEEETTEEEEEE##EEEEcTTcccccGGGccccEEEEEEETTEEEEEEEEccc##### DISOP:02AL 1-4, 100-109, 134-138| PSIPRED ccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHcccccEEEcccccEEEcHHHHHHHHHHHccccccccEEEcccEEEEEEccccEEEEEEEEEEEEccccccccccccHHHHEEEEEEcccEEEEEEEccEEEccc //