[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57138.1
DDBJ      :             putative DNA-binding protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.35.1
:144 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  16->84 2b5aA1 a.35.1.3 * 0.00038 29.4 %
:HMM:PFM   38->76 PF01381 * HTH_3 3.1e-07 36.1 36/55  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57138.1 GT:GENE BAD57138.1 GT:PRODUCT putative DNA-binding protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2467176..2467610) GB:FROM 2467176 GB:TO 2467610 GB:DIRECTION - GB:PRODUCT putative DNA-binding protein GB:PROTEIN_ID BAD57138.1 LENGTH 144 SQ:AASEQ MTSAQFKSRLNRLIERWEAEHGTTVTNAMLIERMGRAGYSVSPAYLSQLRTGRRNNPSPAFLAALAEAMDAPPDYFLYGDAVDGGGDGNSDDGLLGDVRDPKLRGLMRAAAGLSEDSQRLLISLADKLRDAEGRSGGTTAELYP GT:EXON 1|1-144:0| SEG 57->73|pspaflaalaeamdapp| SEG 77->97|lygdavdgggdgnsddgllgd| HM:PFM:NREP 1 HM:PFM:REP 38->76|PF01381|3.1e-07|36.1|36/55|HTH_3| HM:SCP:REP 16->84|2b5aA1|0.00038|29.4|68/0|a.35.1.3|1/1|lambda repressor-like DNA-binding domains| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 139-140| PSIPRED ccHHHHHHHHHHHEEEEEcccccccccHHHHHHHHHccccccHHHHHHHHHcccccccHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccccccccccccc //