[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57141.1
DDBJ      :             putative transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  56/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.121.1a.4.1
:195 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   33->189 2fd5A PDBj 9e-10 36.7 %
:RPS:PDB   30->194 3br5E PDBj 6e-05 10.6 %
:RPS:SCOP  6->58 2o7tA1  a.4.1.9 * 2e-04 22.6 %
:RPS:SCOP  30->58 1jt0A1  a.4.1.9 * 6e-07 24.1 %
:RPS:SCOP  30->78 3c07A1  a.4.1.9 * 4e-05 24.5 %
:RPS:SCOP  91->192 1sgmA2  a.121.1.1 * 4e-09 11.0 %
:HMM:SCOP  8->86 2fbqA1 a.4.1.9 * 4e-14 29.1 %
:HMM:SCOP  82->192 2fd5A2 a.121.1.1 * 6.7e-24 47.1 %
:HMM:PFM   17->60 PF00440 * TetR_N 1.8e-14 31.8 44/47  
:BLT:SWISS 1->58 TTGR_PSEPU 7e-04 31.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57141.1 GT:GENE BAD57141.1 GT:PRODUCT putative transcriptional regulator GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2470887..2471474) GB:FROM 2470887 GB:TO 2471474 GB:DIRECTION - GB:PRODUCT putative transcriptional regulator GB:PROTEIN_ID BAD57141.1 LENGTH 195 SQ:AASEQ MPRASRAQAESHRQQVVAAASAQVRAQGAERLTVADVMAAAGLTHGGFYRHFRNKDDLVAQACAAACAEKVAEMREMLATTTDPATARRDYLRHYLSARHRDHPDHGCGIAALVTDVVRAPHDSPLRRTYLDGLRNMIDGLAEFGDRPDDPDDRERDVLAELALMVGALVLARATADDDLSDRFLTAARDHLGGE GT:EXON 1|1-195:0| BL:SWS:NREP 1 BL:SWS:REP 1->58|TTGR_PSEPU|7e-04|31.0|58/210| SEG 14->29|qqvvaaasaqvraqga| SEG 59->73|vaqacaaacaekvae| SEG 79->90|atttdpatarrd| SEG 146->157|drpddpddrerd| BL:PDB:NREP 1 BL:PDB:REP 33->189|2fd5A|9e-10|36.7|147/180| RP:PDB:NREP 1 RP:PDB:REP 30->194|3br5E|6e-05|10.6|160/186| HM:PFM:NREP 1 HM:PFM:REP 17->60|PF00440|1.8e-14|31.8|44/47|TetR_N| RP:SCP:NREP 4 RP:SCP:REP 6->58|2o7tA1|2e-04|22.6|53/78|a.4.1.9| RP:SCP:REP 30->58|1jt0A1|6e-07|24.1|29/71|a.4.1.9| RP:SCP:REP 30->78|3c07A1|4e-05|24.5|49/75|a.4.1.9| RP:SCP:REP 91->192|1sgmA2|4e-09|11.0|100/111|a.121.1.1| HM:SCP:REP 8->86|2fbqA1|4e-14|29.1|79/0|a.4.1.9|1/1|Homeodomain-like| HM:SCP:REP 82->192|2fd5A2|6.7e-24|47.1|102/0|a.121.1.1|1/1|Tetracyclin repressor-like, C-terminal domain| OP:NHOMO 67 OP:NHOMOORG 56 OP:PATTERN -------------------------------------------------------------------- -11-1--------------------1----------11--------------1-----------1--1-------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------1--1----------212---11111------------------------411-11-111--------------------------------------------------------------------1-----------------1---------11122-----------------1---1-1----------------------------------------------------------------------------------------1------------------------------2------------------------------------1------------------------------1--------------------------1-----------------111111-----------22-----1-121-------------------------1----------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 165 STR:RPRED 84.6 SQ:SECSTR #############################TcccHHHHHHHTTccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHTTcccHHHHHHHHHHHHHHHccccTTTTHHHHHHHHHHHHHTcccHHHHHHHHHHHHHHHHHHHHHHHTTTccccccHHHHHHHHHHHHHHHTcTTccHHHHHHHHHHHHHHHHHT# DISOP:02AL 1-15| PSIPRED cccccHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHcccccHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcc //