[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57143.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  7/915 : Eukaryota  18/199 : Viruses  0/175   --->[See Alignment]
d.80.1
:141 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->140 3c6vB PDBj 7e-27 41.6 %
:RPS:PDB   1->140 3c6vB PDBj 3e-18 39.9 %
:RPS:SCOP  10->117 1mwwA  d.80.1.4 * 9e-14 14.2 %
:HMM:SCOP  2->63 1bjpA_ d.80.1.1 * 0.00011 23.0 %
:HMM:PFM   5->57 PF01361 * Tautomerase 2e-07 26.9 52/60  
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57143.1 GT:GENE BAD57143.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2472299..2472724 GB:FROM 2472299 GB:TO 2472724 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57143.1 LENGTH 141 SQ:AASEQ MPLWHIYHPPATYTEADKQQFAQAVTRSYRSWGLPDFYVVVLFHEIAAVDCYVGGRPADSTVRVVVEHLARQLEDPDMRRIMTEKLDTVMAPFTHDRGLHCEFHVDETPRDLWMIGGLHPPPAGSAAEKQWVAAGKPVPYH GT:EXON 1|1-141:0| TM:NTM 1 TM:REGION 32->54| BL:PDB:NREP 1 BL:PDB:REP 2->140|3c6vB|7e-27|41.6|137/144| RP:PDB:NREP 1 RP:PDB:REP 1->140|3c6vB|3e-18|39.9|138/144| HM:PFM:NREP 1 HM:PFM:REP 5->57|PF01361|2e-07|26.9|52/60|Tautomerase| RP:SCP:NREP 1 RP:SCP:REP 10->117|1mwwA|9e-14|14.2|106/120|d.80.1.4| HM:SCP:REP 2->63|1bjpA_|0.00011|23.0|61/62|d.80.1.1|1/1|Tautomerase/MIF| OP:NHOMO 32 OP:NHOMOORG 25 OP:PATTERN -------------------------------------------------------------------- --------------1---------------------1-4--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------1----------------------------------------------------------------1----------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ----------------12--1112221-------------------1--1-1-----11---------------------------------1---------1---------------------------------------------------------------------------------1----1--------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 140 STR:RPRED 99.3 SQ:SECSTR ccEEEEEEcTTcccHHHHHHHHHHHHHHHHTTTccGGGcEEEEEEccTTccccTTcccccEEEEEEEEEcccccccHHHHHHHHHHHHHHHHHHGGGTcEEEEEEEEEcGGGcccTTcccccTTcHHHHHHHHHTccccc# DISOP:02AL 136-141| PSIPRED ccccccccccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHcccccccEEEcccccccEEEEHHHHHHHccccHHHHHHHHHHHHHHHcccccccccEEEEEEccccccEEEEccccccccccHHHHHHHHcccccccc //