[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57144.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  26/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
d.129.3
:160 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->153 1zxfA PDBj 2e-17 33.8 %
:RPS:PDB   8->152 1b6fA PDBj 5e-09 16.2 %
:RPS:SCOP  7->153 1zxfA1  d.129.3.5 * 1e-46 33.8 %
:HMM:SCOP  4->157 2gkcA1 d.129.3.5 * 9.6e-38 37.6 %
:RPS:PFM   53->90 PF08327 * AHSA1 8e-04 55.3 %
:HMM:PFM   18->156 PF08327 * AHSA1 4.6e-18 25.9 116/123  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57144.1 GT:GENE BAD57144.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2472970..2473452) GB:FROM 2472970 GB:TO 2473452 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57144.1 LENGTH 160 SQ:AASEQ MTTSTLPTLRGTATVALPLARAFAFFTDSFGSWWPAAYHIGSAEMADAVVEPRVGGRWYERGVDGSECDWGRVLAWEPPHRLLLTWQINGHWQFDPDPRRASEIEIRFTAYTPEQTTVTLEHRHLDRLVDGRAIHDTIAERGGGWSTLLELFRRTAESAS GT:EXON 1|1-160:0| BL:PDB:NREP 1 BL:PDB:REP 7->153|1zxfA|2e-17|33.8|139/155| RP:PDB:NREP 1 RP:PDB:REP 8->152|1b6fA|5e-09|16.2|142/159| RP:PFM:NREP 1 RP:PFM:REP 53->90|PF08327|8e-04|55.3|38/124|AHSA1| HM:PFM:NREP 1 HM:PFM:REP 18->156|PF08327|4.6e-18|25.9|116/123|AHSA1| GO:PFM:NREP 1 GO:PFM GO:0006950|"GO:response to stress"|PF08327|IPR013538| RP:SCP:NREP 1 RP:SCP:REP 7->153|1zxfA1|1e-46|33.8|139/155|d.129.3.5| HM:SCP:REP 4->157|2gkcA1|9.6e-38|37.6|149/0|d.129.3.5|1/1|Bet v1-like| OP:NHOMO 30 OP:NHOMOORG 27 OP:PATTERN -------------------------------------------------------------------- -----------------11-1-----11111-11111--1-----1--------------21-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------3--------11----1--1--------------------1---------1----1------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 158 STR:RPRED 98.8 SQ:SECSTR ##cTTcEEccEEEEEcccHHHHHHHHTTTHHHHHHHHcTTTcccEEEEEccccTTcEEEEcccccccccccEEEEEETTTTEEEEEEcccccTTccccTTEEEEEEEEEEcETTTEEEEEEEEEEEccTTccccHHHHHHHHHHHHHHHHHHHHHHTcHc DISOP:02AL 1-3, 156-160| PSIPRED ccccccccEEEEEEEEccHHHHHHHHHHccccccccccEEEEccccccEEEEccccEEEEcccccccccEEEEEEEccccEEEEEEEEccccccccccccEEEEEEEEEEEccccEEEEEEEEEcccccccHHHHHccccccccHHHHHHHHHHHHHccc //