[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57145.1
DDBJ      :             putative transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  123/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:111 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   9->87 3f6vA PDBj 2e-15 41.8 %
:RPS:PDB   14->87 1bibA PDBj 1e-14 27.0 %
:RPS:SCOP  9->79 1fnnA1  a.4.5.11 * 3e-14 16.9 %
:HMM:SCOP  9->96 2p4wA1 a.4.5.64 * 1.6e-23 37.5 %
:RPS:PFM   14->58 PF01022 * HTH_5 4e-08 55.6 %
:HMM:PFM   14->58 PF01022 * HTH_5 1.6e-13 48.9 45/47  
:HMM:PFM   47->80 PF03551 * PadR 0.00047 26.5 34/86  
:BLT:SWISS 5->76 YUZN_BACSU 6e-08 43.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57145.1 GT:GENE BAD57145.1 GT:PRODUCT putative transcriptional regulator GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2473449..2473784) GB:FROM 2473449 GB:TO 2473784 GB:DIRECTION - GB:PRODUCT putative transcriptional regulator GB:PROTEIN_ID BAD57145.1 LENGTH 111 SQ:AASEQ MAAFRDVDLAILGDPTRRAIFERLARRPSSVGELAESLPITRQAVSQHLRVLRDGGLVVATAQGTRRIYRINPEGLAAIQAYFQQIWDEALTAFQKAADAAATDPGQEHRT GT:EXON 1|1-111:0| BL:SWS:NREP 1 BL:SWS:REP 5->76|YUZN_BACSU|6e-08|43.1|72/92| SEG 90->102|altafqkaadaaa| BL:PDB:NREP 1 BL:PDB:REP 9->87|3f6vA|2e-15|41.8|79/96| RP:PDB:NREP 1 RP:PDB:REP 14->87|1bibA|1e-14|27.0|74/294| RP:PFM:NREP 1 RP:PFM:REP 14->58|PF01022|4e-08|55.6|45/47|HTH_5| HM:PFM:NREP 2 HM:PFM:REP 14->58|PF01022|1.6e-13|48.9|45/47|HTH_5| HM:PFM:REP 47->80|PF03551|0.00047|26.5|34/86|PadR| GO:PFM:NREP 3 GO:PFM GO:0003700|"GO:transcription factor activity"|PF01022|IPR001845| GO:PFM GO:0005622|"GO:intracellular"|PF01022|IPR001845| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF01022|IPR001845| RP:SCP:NREP 1 RP:SCP:REP 9->79|1fnnA1|3e-14|16.9|71/103|a.4.5.11| HM:SCP:REP 9->96|2p4wA1|1.6e-23|37.5|88/0|a.4.5.64|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 209 OP:NHOMOORG 123 OP:PATTERN -------------------------------------------------------------------- 133-3---------31122-21--1-22222132224432---11411---12121-2--3-1-2-3-11-------------------------------1--11-11----------------------------11---------------------------1----------------1----------11111111-111111--11--112-------------11--------------------------------------------------------------------------------------------------------------------------------------------3--1112------1431------------------1---1-----255-311143133233--1-1-21------1------------------------------------------------21-----1-------------1-----------1------2-----1---------------------------------------------------111244-------------------------------------------------------------------------------------------------------------------------------------2-----------------------------------------------------------------1------------------------------------------1----------------11---------------------------------------------------1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 89 STR:RPRED 80.2 SQ:SECSTR ccccTTccHHHHccHHHHHHHHHHTTccccHHHHHHHHTccHHHHHHHHHHHHHTTcccEEETTTEEEcccccccccHHHHHHTccccc###################### DISOP:02AL 1-3, 100-111| PSIPRED ccHHHHHHHHHHccHHHHHHHHHHHcccccHHHHHHHHcccHHHHHHHHHHHHHcccEEEEccccEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccc //