[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57149.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:140 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   7->79 PF03209 * PUCC 0.00033 19.7 71/403  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57149.1 GT:GENE BAD57149.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2476153..2476575) GB:FROM 2476153 GB:TO 2476575 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57149.1 LENGTH 140 SQ:AASEQ MNYVAPLFVGAVYIVLMSLIREPHRRQFNAIMVAGAGAAYLSGGGFGIWEFAFTALVTYCAYRGLRSWRFIGIAWLLHTVWDAVHHLKGNPIVPFLHDSSLGCAICDPVIAVWALRGGPDVIAWARGKLGATRPTTAEVP GT:EXON 1|1-140:0| TM:NTM 4 TM:REGION 2->24| TM:REGION 43->65| TM:REGION 67->89| TM:REGION 97->119| SEG 34->47|agagaaylsgggfg| HM:PFM:NREP 1 HM:PFM:REP 7->79|PF03209|0.00033|19.7|71/403|PUCC| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------1------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 135-140| PSIPRED cccHHHHHHHHHHHHHHHHHHcccccccHHEEEcccccEEEEcccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccccccEEEccccccHHHHHHHHHHHHHcccccEEEEcccccccccccccccc //