[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57154.1
DDBJ      :             putative transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  20/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.121.1a.4.1
:233 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   21->66 2optB PDBj 7e-09 50.0 %
:RPS:PDB   17->66 2dt5A PDBj 1e-07 18.0 %
:RPS:SCOP  23->66 1jt0A1  a.4.1.9 * 4e-08 18.2 %
:RPS:SCOP  107->220 2g7lA2  a.121.1.1 * 2e-04 18.0 %
:HMM:SCOP  18->80 2g7lA1 a.4.1.9 * 9.6e-11 33.3 %
:HMM:SCOP  87->231 2g7gA2 a.121.1.1 * 1e-29 40.0 %
:RPS:PFM   107->220 PF02909 * TetR_C 2e-04 37.4 %
:HMM:PFM   84->226 PF02909 * TetR_C 6.6e-24 34.8 135/139  
:HMM:PFM   26->70 PF00440 * TetR_N 1.4e-11 26.7 45/47  
:BLT:SWISS 20->66 TETR5_ECOLX 3e-05 40.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57154.1 GT:GENE BAD57154.1 GT:PRODUCT putative transcriptional regulator GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2480532..2481233 GB:FROM 2480532 GB:TO 2481233 GB:DIRECTION + GB:PRODUCT putative transcriptional regulator GB:PROTEIN_ID BAD57154.1 LENGTH 233 SQ:AASEQ MAEPRRGVWFEDARGGRKPRLSRERIVEAAVGLLDAEGVEGFSMRRLAARLQAGTMSLYEYVAGKEDVLDLALDAALADIPLGDDGADWETALAERLRRFRRTMRRHPWIPRLLGTRPLLGPNALARSERTYADLLGAGLTGPGLVAAVSALTAYVQGFVTSELAWRSWVRDPADEAGLRRDAQERIAAHAQRYPTLHEHARLADADFDAGFEHGLRIILDGVRARAAAGDAR GT:EXON 1|1-233:0| BL:SWS:NREP 1 BL:SWS:REP 20->66|TETR5_ECOLX|3e-05|40.4|47/211| SEG 67->88|dvldlaldaaladiplgddgad| SEG 90->106|etalaerlrrfrrtmrr| SEG 111->122|prllgtrpllgp| SEG 221->232|dgvraraaagda| BL:PDB:NREP 1 BL:PDB:REP 21->66|2optB|7e-09|50.0|46/205| RP:PDB:NREP 1 RP:PDB:REP 17->66|2dt5A|1e-07|18.0|50/210| RP:PFM:NREP 1 RP:PFM:REP 107->220|PF02909|2e-04|37.4|107/140|TetR_C| HM:PFM:NREP 2 HM:PFM:REP 84->226|PF02909|6.6e-24|34.8|135/139|TetR_C| HM:PFM:REP 26->70|PF00440|1.4e-11|26.7|45/47|TetR_N| GO:PFM:NREP 2 GO:PFM GO:0016481|"GO:negative regulation of transcription"|PF02909|IPR004111| GO:PFM GO:0016566|"GO:specific transcriptional repressor activity"|PF02909|IPR004111| RP:SCP:NREP 2 RP:SCP:REP 23->66|1jt0A1|4e-08|18.2|44/71|a.4.1.9| RP:SCP:REP 107->220|2g7lA2|2e-04|18.0|100/133|a.121.1.1| HM:SCP:REP 18->80|2g7lA1|9.6e-11|33.3|63/0|a.4.1.9|1/1|Homeodomain-like| HM:SCP:REP 87->231|2g7gA2|1e-29|40.0|130/0|a.121.1.1|1/1|Tetracyclin repressor-like, C-terminal domain| OP:NHOMO 28 OP:NHOMOORG 20 OP:PATTERN -------------------------------------------------------------------- ----1---------------------------1-1-3-32--11-1--------------1-----2-22--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111--1----------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 54 STR:RPRED 23.2 SQ:SECSTR ############cccccHHHHHHHHHHHHHHHHHHHTTccEEcHHHHHHHHTccHHHHHHHHHHTT####################################################################################################################################################################### DISOP:02AL 1-25, 228-233| PSIPRED ccccccccccccccccccccccHHHHHHHHHHHHHHcccccccHHHHHHHHcccccccEEEcccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHcccccc //