[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57161.1
DDBJ      :             putative LSR2 protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  54/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:114 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   1->97 PF11774 * Lsr2 2e-17 59.4 %
:HMM:PFM   1->109 PF11774 * Lsr2 1.3e-43 62.0 108/110  
:BLT:SWISS 1->97 LSR2_MYCTU 2e-22 53.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57161.1 GT:GENE BAD57161.1 GT:PRODUCT putative LSR2 protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2488125..2488469 GB:FROM 2488125 GB:TO 2488469 GB:DIRECTION + GB:PRODUCT putative LSR2 protein GB:PROTEIN_ID BAD57161.1 LENGTH 114 SQ:AASEQ MARKVVVTIVDDYDGESQAAETVSFGLDGVGYEIDLSEQNAAALRQIFEQWTPYARKVGKSGRSRSVKQRERGDQEQAAAIREWARRNGYEVSSRGRVSADVVAAYKAAHADGD GT:EXON 1|1-114:0| BL:SWS:NREP 1 BL:SWS:REP 1->97|LSR2_MYCTU|2e-22|53.6|97/112| SEG 98->113|vsadvvaaykaahadg| RP:PFM:NREP 1 RP:PFM:REP 1->97|PF11774|2e-17|59.4|96/110|Lsr2| HM:PFM:NREP 1 HM:PFM:REP 1->109|PF11774|1.3e-43|62.0|108/110|Lsr2| OP:NHOMO 89 OP:NHOMOORG 54 OP:PATTERN -------------------------------------------------------------------- ----1--------111111-12111111111111113284-1121211123-231111--33112232214---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 55-80, 110-114| PSIPRED cccEEEEEEEEcccccccccEEEEEEEccEEEEEEEcHHHHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHccccccccccccHHHHHHHHHHccccc //