[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57163.1
DDBJ      :             putative membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  17/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:249 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   67->120 PF06532 * DUF1109 0.00051 18.5 54/204  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57163.1 GT:GENE BAD57163.1 GT:PRODUCT putative membrane protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2489371..2490120) GB:FROM 2489371 GB:TO 2490120 GB:DIRECTION - GB:PRODUCT putative membrane protein GB:PROTEIN_ID BAD57163.1 LENGTH 249 SQ:AASEQ MRSIRFRGRGVVGKGGNVFGQAVNKIVLTAIDTGARAQTPLVEKYGDWLRRAHPAESPEQLLHRARKHYLVAVTASGVAAGMCAAVPGIGLITGFAAMGVDTVFFVEASVFYALTAAALAGEETELIARQATLLSGIVFGAEGARLLGKESAGSAKNWADELADRLPIIGEMDDSALKRLVVRAIAKRSVLAFGRVIPAGIGAVVGAAGNRMLAKSVIRNADKAFGPGEPTSPERDEAERASVPSASRG GT:EXON 1|1-249:0| TM:NTM 2 TM:REGION 69->91| TM:REGION 99->121| SEG 5->20|rfrgrgvvgkggnvfg| SEG 113->128|altaaalageetelia| SEG 196->209|vipagigavvgaag| HM:PFM:NREP 1 HM:PFM:REP 67->120|PF06532|0.00051|18.5|54/204|DUF1109| OP:NHOMO 18 OP:NHOMOORG 17 OP:PATTERN -------------------------------------------------------------------- -------1------1------111-1------11112111---------11-1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7, 154-156, 246-249| PSIPRED cccccccccEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHccccccc //