Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57165.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:58 amino acids
:HMM:PFM   12->45 PF04600 * DUF571 0.00026 43.8 32/425  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57165.1 GT:GENE BAD57165.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2492153..2492329 GB:FROM 2492153 GB:TO 2492329 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57165.1 LENGTH 58 SQ:AASEQ MRKVAGMRIEAVRTAVTIGVAAAVLAAGFVVAQRALPADRALAEAQRGPAPVYTDRTG GT:EXON 1|1-58:0| SEG 11->32|avrtavtigvaaavlaagfvva| HM:PFM:NREP 1 HM:PFM:REP 12->45|PF04600|0.00026|43.8|32/425|DUF571| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6, 53-58| PSIPRED cccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHcccccccccccc //