[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57166.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:155 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   103->146 PF08669 * GCV_T_C 0.00074 29.3 41/95  
:BLT:SWISS 15->92 FLGH1_VIBPA 7e-05 40.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57166.1 GT:GENE BAD57166.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2492386..2492853 GB:FROM 2492386 GB:TO 2492853 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57166.1 LENGTH 155 SQ:AASEQ MSRRQIEQRAIKETAMTEPNDTFDPPQDTGAPDSVETDPAALNSAEDLDEDRLRSDPLEAGMDPPEHWTAADKYGTTPWEQAHPRPIGDRLTEEEPDIDPDRQAPPADDQRLTDIAADNGEEVGPATSYEESLGVEADVAGGSVADDIRRPEPPE GT:EXON 1|1-155:0| BL:SWS:NREP 1 BL:SWS:REP 15->92|FLGH1_VIBPA|7e-05|40.8|76/100| SEG 96->111|pdidpdrqappaddqr| HM:PFM:NREP 1 HM:PFM:REP 103->146|PF08669|0.00074|29.3|41/95|GCV_T_C| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1---------------------------111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-9, 100-114, 147-148, 150-155| PSIPRED ccHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHccccccccccccHHHHHcccccccccccccccccccccEEEEccccccccccccccHHHHHHHHHccccccccccccHHcccccccccccccHHHcccccccc //