[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57167.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  26/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:196 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   100->165 PF07332 * DUF1469 0.00022 33.3 60/121  
:HMM:PFM   66->104 PF07158 * MatC_N 0.00066 37.8 37/149  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57167.1 GT:GENE BAD57167.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2492769..2493359) GB:FROM 2492769 GB:TO 2493359 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57167.1 LENGTH 196 SQ:AASEQ MTLDDDDGWNRRARGETKTQRLDRNWSHLLQELRVLQTGVQLLTGFLVTLPFQPGFADLDTGMRAIYLTTMGASVAATVFVVAPVAWHRVLFRRHRLEQLVAAAHRFAAAGMVCLAVALTGALVLVVDRILGEEAAAAAAVVLAVSFLLAWMIGPWRRRGHRQAPRRSPHSGGSGRRMSSATEPPATSASTPSDSS GT:EXON 1|1-196:0| TM:NTM 4 TM:REGION 34->55| TM:REGION 68->89| TM:REGION 102->124| TM:REGION 134->156| SEG 73->86|asvaatvfvvapva| SEG 115->127|lavaltgalvlvv| SEG 135->150|aaaaaavvlavsflla| SEG 166->195|rrsphsggsgrrmssateppatsastpsds| HM:PFM:NREP 2 HM:PFM:REP 100->165|PF07332|0.00022|33.3|60/121|DUF1469| HM:PFM:REP 66->104|PF07158|0.00066|37.8|37/149|MatC_N| OP:NHOMO 33 OP:NHOMOORG 26 OP:PATTERN -------------------------------------------------------------------- --------------111-------11------21112132-21111------111-------1---1211----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 4-7, 10-20, 159-196| PSIPRED cccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccc //