[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57168.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:144 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   23->140 PF07332 * DUF1469 1.9e-37 45.3 117/121  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57168.1 GT:GENE BAD57168.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2493751..2494185 GB:FROM 2493751 GB:TO 2494185 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57168.1 LENGTH 144 SQ:AASEQ MTDTTGAHLTEQARSTTQSRSTAELVEDATAQVSRLIRDEFRLAQLEMQRKARGIGIGAGLAGAAGLLAFYGGAALVAAAVFALNIPLPDWAAALIVAAALLLVAGVLALAGKKKVDNATPPVPQEAVRGVEDDIRAIRNGTRR GT:EXON 1|1-144:0| TM:NTM 2 TM:REGION 58->80| TM:REGION 91->112| SEG 54->84|gigigaglagaagllafyggaalvaaavfal| SEG 92->111|aaalivaaalllvagvlala| HM:PFM:NREP 1 HM:PFM:REP 23->140|PF07332|1.9e-37|45.3|117/121|DUF1469| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 140-144| PSIPRED cccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHcccc //