[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57169.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:132 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   15->58 PF12277 * DUF3618 1.6e-11 29.5 44/49  
:HMM:PFM   49->130 PF05957 * DUF883 3.2e-06 29.3 82/94  
:PROS 29->46|PS00216|SUGAR_TRANSPORT_1
:TM
:COIL
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57169.1 GT:GENE BAD57169.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2494182..2494580 GB:FROM 2494182 GB:TO 2494580 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57169.1 LENGTH 132 SQ:AASEQ MSDTEPNSTSPDALADAVREDRDQARRELGETVDELGRKLDVRARGKEKVNDTVHAAQQAANEAVLAAEDKAAQAGRRAKEAIARAEAKVPEPVAQSGRHAADTARRQPVPLVLGAVGAGVLVWWLLRRRRS GT:EXON 1|1-132:0| PROS 29->46|PS00216|SUGAR_TRANSPORT_1|PDOC00190| COIL:NAA 40 COIL:NSEG 1 COIL:REGION 51->90| TM:NTM 1 TM:REGION 108->127| SEG 56->89|aaqqaaneavlaaedkaaqagrrakeaiaraeak| SEG 109->131|pvplvlgavgagvlvwwllrrrr| HM:PFM:NREP 2 HM:PFM:REP 15->58|PF12277|1.6e-11|29.5|44/49|DUF3618| HM:PFM:REP 49->130|PF05957|3.2e-06|29.3|82/94|DUF883| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-12, 22-26, 71-83, 96-98| PSIPRED ccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHcccHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcc //