[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57174.1
DDBJ      :             putative transporter
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  444/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.92.2
:303 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   33->301 1toaA PDBj 2e-24 29.4 %
:RPS:PDB   33->298 3cx3A PDBj 1e-32 20.8 %
:RPS:SCOP  33->302 1xvlA1  c.92.2.2 * 3e-56 24.5 %
:HMM:SCOP  26->302 1toaA_ c.92.2.2 * 2e-70 38.5 %
:RPS:PFM   33->300 PF01297 * SBP_bac_9 6e-29 31.9 %
:HMM:PFM   8->300 PF01297 * SBP_bac_9 4.5e-72 37.4 286/303  
:BLT:SWISS 35->301 MNTA_BACHD 1e-27 27.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57174.1 GT:GENE BAD57174.1 GT:PRODUCT putative transporter GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2498418..2499329 GB:FROM 2498418 GB:TO 2499329 GB:DIRECTION + GB:PRODUCT putative transporter GB:PROTEIN_ID BAD57174.1 LENGTH 303 SQ:AASEQ MRTILRLLAVVTALVLAAGCADGGGRGEGVVVTTNILGDLTAAVVGDAAEVTVLMSPGADPHHFAVSAQQAAVLERASLIVHNGLGLEEGVARHVTAAAEAGVPTLAVGERVDPLRFRPEVGADRPDPHFWTDPRRVARAVEALRDAVLEHTGADPDIVRARTENYLRELDELDRWMTERFATVPPERRKLVTNHHVFGYLAQRFGFEVIGAVIPGGTTLASPSPADLAELAGAVRAAGVGAVFADTAQPDRLARVLAEQAGLHVRVIGLHSESLSPPGGGAATYLEMMRSNTEAIVAGLAAP GT:EXON 1|1-303:0| BL:SWS:NREP 1 BL:SWS:REP 35->301|MNTA_BACHD|1e-27|27.0|259/300| TM:NTM 2 TM:REGION 2->23| TM:REGION 33->55| SEG 7->32|llavvtalvlaagcadgggrgegvvv| SEG 226->245|adlaelagavraagvgavfa| BL:PDB:NREP 1 BL:PDB:REP 33->301|1toaA|2e-24|29.4|265/277| RP:PDB:NREP 1 RP:PDB:REP 33->298|3cx3A|1e-32|20.8|250/259| RP:PFM:NREP 1 RP:PFM:REP 33->300|PF01297|6e-29|31.9|260/291|SBP_bac_9| HM:PFM:NREP 1 HM:PFM:REP 8->300|PF01297|4.5e-72|37.4|286/303|SBP_bac_9| GO:PFM:NREP 2 GO:PFM GO:0030001|"GO:metal ion transport"|PF01297|IPR006127| GO:PFM GO:0046872|"GO:metal ion binding"|PF01297|IPR006127| RP:SCP:NREP 1 RP:SCP:REP 33->302|1xvlA1|3e-56|24.5|265/279|c.92.2.2| HM:SCP:REP 26->302|1toaA_|2e-70|38.5|273/277|c.92.2.2|1/1|"Helical backbone" metal receptor| OP:NHOMO 612 OP:NHOMOORG 448 OP:PATTERN ---------------------------1------------------1-1------------------2 ----113-111212-------1---1------21112122-1-1221-11--21111---22-12111112-------1---1-------------1---------1---111111111111111------1-1--22222-114112232212122312222-12243221211-113111121-11-1--1-11111--121---1-111112-1-2-1112-12222122111111111111111111113-1-11-----11--111---1-21222233332222222222222133323333333332111111112-11111111111111--11-111--11-2--1-33111--111111--11--1----222211111111111122----------1-111112-1111122211112211112---1121111111------------1112-----------------------------------11111-------------1---------1---------1-----1-111--1----11-111111--112---2------1---1-2-21-----------1----1----------------1--------1-----------------------------1-11-------4-12-22---1-122-------2-1-1--21------222221111111111111111111211111112-211111111111--1-------------1-1-1-1-111111111-----------------222----1-111---------12--------111-------------------1--------------12----------------------------1--1-1111-- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 270 STR:RPRED 89.1 SQ:SECSTR ################################ccHHHHHHHHHHHTTccEcEEEccccccTTTccccHHHHHHHHHccEEEEccTTTccTTTTccTTTTTcccEEEETTTTcccccGccccccccccccGGGcHHHHHHHHHHHHHHHHHHcGGGHHHHHHHHHHHHHHHHHHHHHHHHHHHcccGGcccEEEEEcccHHHHHHTTccEEEEEEEcccTTcccccHHHHHHHHHHHHTTcccEEEccccccHHHHHHHccccccEEEcccccccccccccccccHHHHHHHHHHHHHcHHcc# DISOP:02AL 220-221, 302-303| PSIPRED cHHHHHHHHHHHHHHHHHccccccccccEEEEEEHHHHHHHHHHcccEEEEEEEEccccccccccccHHHHHHHHHccEEEEEccccHHHHHHHHHHHcccccEEEEEcccccccccccccccccccccEEEcHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEcccHHHHHHHcccccccHHHccccccccccHHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHHccEEEEcccccccccccccccccHHHHHHHHHHHHHHHHccc //