[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57175.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  33/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.69.2
:398 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  306->391 1jmxB  b.69.2.2 * 4e-07 21.2 %
:HMM:SCOP  54->393 1jjuB_ b.69.2.2 * 8.1e-18 25.1 %
:BLT:SWISS 213->370 PKWA_THECU 4e-04 29.3 %
:REPEAT 2|40->169|262->396
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57175.1 GT:GENE BAD57175.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2499326..2500522 GB:FROM 2499326 GB:TO 2500522 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57175.1 LENGTH 398 SQ:AASEQ MNAIHRKREHHMHIRSTARTATALAGLLTAAVTLTACGSGDDADAQDRAIAEPIAVTFDGGIHVLDGRTLELGGTTRLDGFNRLNPAGDERHLMVSTSEGFRVYDAIAAEFTDISFPGPEPGHVVRHAGRTVLFTDGTGEVVSFDPADLAAGAPPTEVYKTPQPHHGVAVELADGKLVVTLGTEEKRTGLAVLDERRTEITRNEDCPGVHGEAAAEDETVVVGCENGVLVYRGGVITKITSPTPYGRIGNQAGSPESAIVLGDYKQDKDAELERPQQVSLIDTTTGSLRLVDLGASYTFRSLGRGPQGEALVLGTDGRLHVIDPVAGTVVRRIDVLAPWQEPLKWQQPRPALFVRGGDVYVSDPATKQVHRIDLAAGTVAASVTLPDSPNELSGVSAH GT:EXON 1|1-398:0| BL:SWS:NREP 1 BL:SWS:REP 213->370|PKWA_THECU|4e-04|29.3|157/100| NREPEAT 1 REPEAT 2|40->169|262->396| SEG 17->36|tartatalaglltaavtlta| RP:SCP:NREP 1 RP:SCP:REP 306->391|1jmxB|4e-07|21.2|80/339|b.69.2.2| HM:SCP:REP 54->393|1jjuB_|8.1e-18|25.1|291/0|b.69.2.2|1/1|YVTN repeat-like/Quinoprotein amine dehydrogenase| OP:NHOMO 33 OP:NHOMOORG 33 OP:PATTERN -------------------------------------------------------------------- -----1--111----------1---1------11111111----111-11--111111----------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------11-------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------1--------------------------1------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-8, 39-48, 396-398| PSIPRED cccHHHHHHHcEEEEEccccHHHHHHHHHHHHHHHHcccccccccccccccccEEEEEcccEEEEEcccccccccccccccccccccccccEEEEEccccEEEEEcccHHHccEEEEccccEEEEcccccEEEEEcccEEEEEEcccHHHccccccHHHHccccccEEEEEEcccEEEEEcccccccccEEEEEccccEEccccccccccccccccccEEEEEEcccEEEEEcccEEEccccccccEEccccccHHHHHHHHHHccccccHHccccEEEEEcccccEEEEEEccccEEEEEEcccccccEEEEEcccEEEEEEccccEEEEEEcccccccccccccccccEEEccccEEEEEcccccEEEEEEEEcccEEEEEEccccccEEEEEEEc //