[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57178.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:182 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57178.1 GT:GENE BAD57178.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2503549..2504097) GB:FROM 2503549 GB:TO 2504097 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57178.1 LENGTH 182 SQ:AASEQ MPGRLRRALAVAAVVAAVPGCATLFGDPPPPSPEQIARAADEVAALPRAAEAEQSLRTAVEHIAAAAAAHNPALRWSWSGERAEGPCHGPYASVGGLRVVLPRYLAEGSIPASAWPEFRRVAHEFAAAAGAVDLRPDTSTPPHYHLDADGTDGAYWDNQTNLAVFAGPDSMTITANTGCRRP GT:EXON 1|1-182:0| SEG 4->18|rlrralavaavvaav| SEG 64->69|aaaaaa| SEG 117->132|efrrvahefaaaagav| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6, 181-182| PSIPRED ccHHHHHHHHHHHHHHHcccHHHHccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccccEEEEcccccccccccccccccccHHHHHHHHHHcccccccccHHHHHHHHHHHHHcccEEccccccccccEEEcccccccccccccccEEEEEccccEEEEEccccccc //