[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57180.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:179 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   131->174 PF04306 * DUF456 0.00029 34.1 44/140  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57180.1 GT:GENE BAD57180.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2504941..2505480) GB:FROM 2504941 GB:TO 2505480 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57180.1 LENGTH 179 SQ:AASEQ MRVHRFAATALLAIGATTFTAGTAHAAPAAPEIAGVEQGIGFTAGPTTDGTGLVTRIDSGTFRAIGDAVVLTDAAGLPVAAVPATVQVDGAAVTLSPQISDAGRTLTLTPVGAPAASERLASFVDQDETLARKQHNAGVGALIGAGIGAVFGFFLGGVGALVTVPIGAGIGALIGFATP GT:EXON 1|1-179:0| TM:NTM 2 TM:REGION 1->18| TM:REGION 146->168| SEG 6->34|faatallaigattftagtahaapaapeia| SEG 137->162|agvgaligagigavfgfflggvgalv| SEG 166->177|igagigaligfa| HM:PFM:NREP 1 HM:PFM:REP 131->174|PF04306|0.00029|34.1|44/140|DUF456| OP:NHOMO 2 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------2-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4| PSIPRED cccHHHHHHHHHHHHHHHHccccccccccccccccccccccEEEEEEEcccEEEEEEcccEEEEEccEEEEEcccccEEEEEEEEEEEccEEEEEccEEcccccEEEEEEcccccccccccccccHHHHHHHHHcccccHHHHHHHHHHHHHHHHccccEEEEEEccccHHHHHccccc //