[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57181.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:172 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57181.1 GT:GENE BAD57181.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2505625..2506143) GB:FROM 2505625 GB:TO 2506143 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57181.1 LENGTH 172 SQ:AASEQ MPFAGGVRACRPRQDRLPRRALVNLPDMAIDEDSLPSVDTLDEVTEIARAHDSVFLRYSRGPAADARSGPSRDFEAEVELPGWSVTTVTPEPWWPRPDRDWVARRLCKYAELGAAHGRFPWLLIGRVVGRGPDHEPLVADMTPIARVSEAALAEAERVYGERFHVGRDSTSD GT:EXON 1|1-172:0| SEG 92->101|pwwprpdrdw| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1----------------------------11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 67-72, 166-172| PSIPRED ccccccccccccHHHcccHHHHcccccccccccccccHHHHHHHHHHHHccccEEEEEccccccHHHcccccccHHcccccccccccccccccccccHHHHHHHHHHHHHHcccccccccEEEEEEEEccccccccEEEEccccccccHHHHHHHHHHHHHHHHcccccccc //