Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57185.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:104 amino acids

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57185.1 GT:GENE BAD57185.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2507764..2508078 GB:FROM 2507764 GB:TO 2508078 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57185.1 LENGTH 104 SQ:AASEQ MIDEETRDKIVAAVGGVSGLRPATPLGAGDPAWWPWDTRRYAVDLGPTTVEVRVIAAALPLPPLLNLAAEAVRGVLHGTRWENAALRLVVTELDAAAFADDQGG GT:EXON 1|1-104:0| SEG 56->69|aaalplppllnlaa| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 102-104| PSIPRED ccccHHHHHHHHHHcccccccccccccccccccccccccEEEEEccccEEEEEEEEEcccccHHHHHHHHHHHHHHccccccccEEEEEEEEcccHHccccccc //