[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57186.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  172/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:161 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   34->140 PF03780 * DUF322 1e-15 49.0 %
:HMM:PFM   34->144 PF03780 * DUF322 1.6e-35 46.2 106/108  
:HMM:PFM   148->160 PF03522 * KCl_Cotrans_1 0.00061 46.2 13/30  
:BLT:SWISS 38->143 ASP23_STAAW 2e-20 47.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57186.1 GT:GENE BAD57186.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2508184..2508669 GB:FROM 2508184 GB:TO 2508669 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57186.1 LENGTH 161 SQ:AASEQ MTTATPSKSTGENSAPAPTTAETAPKRNDLVTDQGSTTIADVVVQKVAGLAAREVRGVHALGGGAARAFSAIRDRIPGASASIGQGVSVEVGETQAAVDLEIVVEYGVAIAELARTVRRNVITAIEQMTGLEVVEVNIHVNDVHIPGDDEDETDAAPSRVR GT:EXON 1|1-161:0| BL:SWS:NREP 1 BL:SWS:REP 38->143|ASP23_STAAW|2e-20|47.1|102/169| SEG 15->25|apapttaetap| RP:PFM:NREP 1 RP:PFM:REP 34->140|PF03780|1e-15|49.0|102/107|DUF322| HM:PFM:NREP 2 HM:PFM:REP 34->144|PF03780|1.6e-35|46.2|106/108|DUF322| HM:PFM:REP 148->160|PF03522|0.00061|46.2|13/30|KCl_Cotrans_1| OP:NHOMO 232 OP:NHOMOORG 172 OP:PATTERN -------------------------------------------------------------------- -----1------1-1------------------1111211-11121---33-221--2-----11-1113------------1---------------------------------------------------------------------------------------------------------1--111---------------111111---111-11-11111122-11111111111111111113-1-22-11--22222212122122222222221--111111111112222222222222---111---1133111111111-1-1111-1111111121121221121221-1111-11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-33, 149-157| PSIPRED cccccccccccccccccccHHHcccccccccccccEEEEcHHHHHHHHHHHHHHccEEEEEccccHHHHHHHHHHcccccccccccEEEEEcccEEEEEEEEEEEccccHHHHHHHHHHHHHHHHHHHHccEEEEEEEEEEEEEEcccHHHHHHHHccccc //