[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57187.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:62 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   25->48 PF09527 * ATPase_gene1 0.00012 43.5 23/61  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57187.1 GT:GENE BAD57187.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2508699..2508887 GB:FROM 2508699 GB:TO 2508887 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57187.1 LENGTH 62 SQ:AASEQ MNATTLCLAVGLALGFAVAFGGFGAFAIVLVFALLGLVVGRWLDGELDVAGLVRTAQRRSGR GT:EXON 1|1-62:0| TM:NTM 2 TM:REGION 4->26| TM:REGION 31->53| SEG 8->40|lavglalgfavafggfgafaivlvfallglvvg| HM:PFM:NREP 1 HM:PFM:REP 25->48|PF09527|0.00012|43.5|23/61|ATPase_gene1| OP:NHOMO OP:NHOMOORG 0 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 57-62| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHccc //