[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57189.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:212 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   5->29 PF00556 * LHC 0.00046 24.0 25/40  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57189.1 GT:GENE BAD57189.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2509228..2509866 GB:FROM 2509228 GB:TO 2509866 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57189.1 LENGTH 212 SQ:AASEQ MIRRPRRTLPAVIVALVLLALAVGAIVWAVQRLAGAREFVSYQRVATELHGRTWDDVPVLVTGVVLAALGLVLLVLAIWPGRAVVVPLAGDDGLRGGVTRRGLGTALRASAITVGGVSAARIRVRRKAVKARIRTDRARSEGLAEAVCERLTTRVQEIGPQSVRKVKASVRGGRRAKAEGRRGAKGQLGAEPAAPQPSAAPETVEVTGRGVS GT:EXON 1|1-212:0| TM:NTM 2 TM:REGION 14->36| TM:REGION 63->85| SEG 11->30|avivalvllalavgaivwav| SEG 57->77|vpvlvtgvvlaalglvllvla| SEG 90->105|gddglrggvtrrglgt| SEG 119->134|aarirvrrkavkarir| SEG 171->186|rggrrakaegrrgakg| SEG 190->202|aepaapqpsaape| HM:PFM:NREP 1 HM:PFM:REP 5->29|PF00556|0.00046|24.0|25/40|LHC| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7, 166-199, 211-212| PSIPRED cccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEccccccccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHcHHHHHHHHHHHccccccccccccccccccccccccccccccccEEEEcccccc //