[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57190.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:190 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   12->83 PF11234 * DUF3036 0.00021 22.4 67/155  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57190.1 GT:GENE BAD57190.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2509863..2510435 GB:FROM 2509863 GB:TO 2510435 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57190.1 LENGTH 190 SQ:AASEQ MSGINRPAGTNRTLLGLTGAVLVAAGALLIAAHFGRLAAAGRDEPLVPGTGAPPTWVLVIVIAAGLLAALLCLRWLLAQAFRMPKARAWEIGTATGAGVTTLDTRTAAAPVADDIETYPGVRSASAWLTGTGTEPELHLVVTAEPTADIAELRRRILGHAVARLREALEVSTVPVTLELRFDDGRRGLAR GT:EXON 1|1-190:0| TM:NTM 2 TM:REGION 15->37| TM:REGION 57->79| SEG 13->32|tllgltgavlvaagalliaa| SEG 63->80|aagllaallclrwllaqa| HM:PFM:NREP 1 HM:PFM:REP 12->83|PF11234|0.00021|22.4|67/155|DUF3036| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-8, 189-190| PSIPRED cccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEccccccccEEEEcccccccccHHHHHHcccccccccEEEccccccEEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEEccccccccc //