[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57191.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  53/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
:166 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   9->123 PF01814 * Hemerythrin 0.00036 23.6 55/59  
:BLT:SWISS 11->159 YI06_SCHPO 9e-08 24.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57191.1 GT:GENE BAD57191.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2510518..2511018 GB:FROM 2510518 GB:TO 2511018 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57191.1 LENGTH 166 SQ:AASEQ MSTDAIVLLREDHKEIRKLFREFEKAGDDANATKGRVVDKIIEALTVHTYIENECMYPEVRKLVPELTDDILESYEEHHVADLLVMELATMKPEDEHFTAKTTVLIENVDHHIDEEEHEWFPKVRERLGRKQLQEIGARMLELKKKAPHSPAQPSALKKAVDAVIS GT:EXON 1|1-166:0| BL:SWS:NREP 1 BL:SWS:REP 11->159|YI06_SCHPO|9e-08|24.0|146/203| HM:PFM:NREP 1 HM:PFM:REP 9->123|PF01814|0.00036|23.6|55/59|Hemerythrin| OP:NHOMO 68 OP:NHOMOORG 55 OP:PATTERN -------------------------------------------------------------------- --1-3--1----------------------------1-11--1-1---------------------111--------------------------------------------------------------------------------1------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2--------1--------------------------------------------------------------------------------------------------------------11----------1---------12--------1111---11---1---1--2-11-2--1-----------121-------1--------1-1------112134---------------------------------------------------------------------------------------------------------------------------------------------------------------11111----------------------------------1---------1----1---------------------------------------------------------------------------------------------------- ---------------------------------------------------------------------------------------1-------------------1------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 67-68, 144-159| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHccccccccccccccHHHHHcc //