[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57193.1
DDBJ      :             putative transporter
Swiss-Prot:             

Homologs  Archaea  37/68 : Bacteria  665/915 : Eukaryota  93/199 : Viruses  0/175   --->[See Alignment]
f.38.1
:464 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  1->173 1pw4A  f.38.1.1 * 7e-10 12.2 %
:RPS:SCOP  274->396 1pv6A  f.38.1.2 * 2e-07 19.8 %
:HMM:SCOP  1->458 1pw4A_ f.38.1.1 * 1.3e-79 29.1 %
:RPS:PFM   1->390 PF07690 * MFS_1 7e-22 29.9 %
:HMM:PFM   3->394 PF07690 * MFS_1 2.3e-62 28.4 345/353  
:BLT:SWISS 1->404 YHCA_BACSU 2e-44 26.1 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57193.1 GT:GENE BAD57193.1 GT:PRODUCT putative transporter GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2511993..2513387 GB:FROM 2511993 GB:TO 2513387 GB:DIRECTION + GB:PRODUCT putative transporter GB:PROTEIN_ID BAD57193.1 LENGTH 464 SQ:AASEQ MVVLGAIMSILDVTVVTVALPTFITEFETTYAIAAWTMTGYTLALATVIPITGWAADRFGTKRLYLMALTFFVLGSLLCSVAWNIESLIAFRVIQGLGGGMLMPLGMTIMTHAAGPQRIGRVMAVLGVPMLLGPITGPILGGWLIDAFSWHWIFLINLPIGIVSLVLAYLVLPADEPQPSESFDFLGMLLASPGLALFLYGVSTIPETGTVADAKVLVPAAIGVLLLVGFVFHALRTEHPLIDLHLFRNRALTFSVLTMVLFAIAFFGAGLLLPSYLQQVRGESAMAAGLLMAPQGIGAMLTMPIAGRFVDRIGPGKIVMVGIAVITVSMVFFVQLTDQTSYVALCAALFVMGLGMGCTMMPIMTAAIQTLTHQQVARGSTLMNIINQTAGSIGTATMSVVLSNEMKERSGPAGLPGPAEAAEAFSNTYVVALVLAGLTLIPAFFLPRTRPAATQDADAPMLVH GT:EXON 1|1-464:0| BL:SWS:NREP 1 BL:SWS:REP 1->404|YHCA_BACSU|2e-44|26.1|403/532| TM:NTM 14 TM:REGION 3->25| TM:REGION 34->56| TM:REGION 64->86| TM:REGION 91->113| TM:REGION 122->144| TM:REGION 153->174| TM:REGION 182->204| TM:REGION 213->235| TM:REGION 254->276| TM:REGION 285->307| TM:REGION 315->337| TM:REGION 345->367| TM:REGION 381->403| TM:REGION 426->448| SEG 96->107|glgggmlmplgm| SEG 129->145|pmllgpitgpilggwli| SEG 411->424|gpaglpgpaeaaea| RP:PFM:NREP 1 RP:PFM:REP 1->390|PF07690|7e-22|29.9|344/347|MFS_1| HM:PFM:NREP 1 HM:PFM:REP 3->394|PF07690|2.3e-62|28.4|345/353|MFS_1| GO:PFM:NREP 1 GO:PFM GO:0055085|"GO:transmembrane transport"|PF07690|IPR011701| RP:SCP:NREP 2 RP:SCP:REP 1->173|1pw4A|7e-10|12.2|172/434|f.38.1.1| RP:SCP:REP 274->396|1pv6A|2e-07|19.8|121/417|f.38.1.2| HM:SCP:REP 1->458|1pw4A_|1.3e-79|29.1|385/447|f.38.1.1|1/1|MFS general substrate transporter| OP:NHOMO 4322 OP:NHOMOORG 795 OP:PATTERN ------9545554476-411---2--------2121--1111-986261-341----1--14751--- 4254s336AAA75485666-6811I87777789889JURJ5OFRA7843A728B6425--BHA396DTSM3433345313633131112211-2-----1-41--7-2-2--------------111111-1111-6663421153--1-----------------1--3-------------3441-1-282A889899AB5AC999A62876999933435526455558N354444444444444755564682EF35525DC77FD738A7886533311-1245-----------11111111111111-----1--11--9D111212121135AA1332-----3--2-553331--3321111--11-71121111225B894235622322442443448-344347482C--E444AB4CDC4653-1--111112---5555555544443115------------1111111111111-----1343357468JOPMPJGCBCAJJPMDDCD6EUIQ6A8D--87A-1433525392251-11-432222222---112-1413-21131--311-12113-122324112------------1---------11-66224121--22222222-12433-1111-111-1----------66853845555566655-5555556555565555553BFB776456526444445545464E55465641-955555555555----5535311111-433111121-22-1---155555251133-7778797A356832565221112212-1222333331111154444443221--------------------------------------------------1--------121 ----11-------14AAIADGGDSTTGBB9999NLH8967578987H7DPGGVG77CEC89B344-1114--627211-115554474-BC5A3B454566-4677--2-------------------------------------------------1------------------------------D----2---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 447-459| PSIPRED HHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccc //