[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57194.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  27/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.129.3
:143 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   1->141 2b79B PDBj 5e-08 12.6 %
:RPS:SCOP  3->141 2rerA1  d.129.3.6 * 1e-09 9.4 %
:HMM:SCOP  1->145 1z94A1 d.129.3.5 * 4.6e-20 26.8 %
:HMM:PFM   1->141 PF10604 * Polyketide_cyc2 1.7e-23 28.9 135/139  
:BLT:SWISS 1->143 Y1573_MYCBO 1e-30 40.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57194.1 GT:GENE BAD57194.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2513446..2513877) GB:FROM 2513446 GB:TO 2513877 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57194.1 LENGTH 143 SQ:AASEQ MAKLKVSADVPISPEQAWTHTSDLAGLDKWLTMHEAWRGEVPTELTPGTTLVGVATVKGLRNRVTWTVQTAEPPNRLVLKGSGKGGTKFTLGLLVAPTGTGSQVSVDLELGGAPLFGPIGAGVAKAVRGDIERSLEKFVALYG GT:EXON 1|1-143:0| BL:SWS:NREP 1 BL:SWS:REP 1->143|Y1573_MYCBO|1e-30|40.6|143/143| SEG 79->94|lkgsgkggtkftlgll| RP:PDB:NREP 1 RP:PDB:REP 1->141|2b79B|5e-08|12.6|135/143| HM:PFM:NREP 1 HM:PFM:REP 1->141|PF10604|1.7e-23|28.9|135/139|Polyketide_cyc2| RP:SCP:NREP 1 RP:SCP:REP 3->141|2rerA1|1e-09|9.4|139/155|d.129.3.6| HM:SCP:REP 1->145|1z94A1|4.6e-20|26.8|138/0|d.129.3.5|1/1|Bet v1-like| OP:NHOMO 59 OP:NHOMOORG 27 OP:PATTERN -------------------------------------------------------------------- --------------33322-23112222222243332222--------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 141 STR:RPRED 98.6 SQ:SECSTR EEEEEEEEEEcccHHHHHHHHHcGGGHHHHcTTEEEEEEcccccccTTcEEEEEEEEETTcccEEEEEEEEETTTEEEEEEEETTEEEEEEEEEEEcTTccEEEEEEEEEEccTTccHHHHHHHHHHHHTHHHHHHHHHHH## DISOP:02AL 1-6| PSIPRED cEEEEEEEEEcccHHHHHHHHccHHHcccccEEEEccccccccccccccEEEEEEEEEcccccEEEEEEEEEccEEEEEEcccccEEEEEEEEEEEEcccccEEEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //