[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57197.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  430/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
b.61.6
:183 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   14->151 2fgsA PDBj 2e-22 40.7 %
:RPS:SCOP  12->181 1y0gA  b.61.6.1 * 3e-45 34.8 %
:HMM:SCOP  12->181 1wubA_ b.61.6.1 * 5.9e-51 45.3 %
:RPS:PFM   16->177 PF04264 * YceI 3e-18 44.4 %
:HMM:PFM   13->178 PF04264 * YceI 1.3e-42 38.2 152/159  
:BLT:SWISS 2->183 Y1570_ENT38 9e-25 37.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57197.1 GT:GENE BAD57197.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2515896..2516447 GB:FROM 2515896 GB:TO 2516447 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57197.1 LENGTH 183 SQ:AASEQ MTTGIAKGLTAGTWVIDPAHSTVGFSVRHLMVSKVRGRFTDFDGKLVIGADGTASAEAAIRVDSVTTDNEQRDAHLRTADFFHAAEFPEMTFKSTGFRVDGENFVVDGEFTVRGNTKPVSLDVEFLGVNPGMGQGEVAGFEAKTVVSRRDFGLDIDMPLPDGGAVIGDKITLTLEVEVVKQAS GT:EXON 1|1-183:0| BL:SWS:NREP 1 BL:SWS:REP 2->183|Y1570_ENT38|9e-25|37.0|173/192| BL:PDB:NREP 1 BL:PDB:REP 14->151|2fgsA|2e-22|40.7|135/169| RP:PFM:NREP 1 RP:PFM:REP 16->177|PF04264|3e-18|44.4|153/161|YceI| HM:PFM:NREP 1 HM:PFM:REP 13->178|PF04264|1.3e-42|38.2|152/159|YceI| RP:SCP:NREP 1 RP:SCP:REP 12->181|1y0gA|3e-45|34.8|164/169|b.61.6.1| HM:SCP:REP 12->181|1wubA_|5.9e-51|45.3|170/0|b.61.6.1|1/1|YceI-like| OP:NHOMO 579 OP:NHOMOORG 433 OP:PATTERN --------------------------------------------------------------11---- 2211111111-111111----1--12-----1112121211211221111-1132111----2-1114532----------------------------3-2-11433-2------------------1-----1-11111----1---------------------------------------111---1--------------------------1112111111111-111111111111111111111--------------------------------------------------------------------------------------------------1---------------------2--2441-----21------11-------------1-11-11112--1--11---2-----2-2311-2-1--21111111111-2212-11------------------------------11111-11111111112222211332222122132222-1222131-121112-11121211-1111111---111311---1111-----222-1---233443---3-11-11111111111111111---11111122111111111121-111111-1111----1--------11-1-111111111111-111111111111111111111111211212222222222222211111111--11-111-11111---1-----1111-1111---------------11111121321211111112111111111---------1---1111111111122322222222222---------------------------------------------------------2- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 162 STR:RPRED 88.5 SQ:SECSTR #############ccccGGGcccccccccccccccccEEccEEEEEEEEEEcTTTTEEEEEGGGEEcccHHHHHHHTcTTTTcTTTccEEEEEEEEEEccccEEEEEEEEEETTEEEEEEEEEEEEEEEEcTTccEEEEEEEEEEEETGGGTccccc######cGGGcEEEEEEEEEEEEc## DISOP:02AL 182-183| PSIPRED ccccccccccccEEEEEccccEEEEEEEEEEEEEEEEEEEEEEEEEEEcccccEEEEEEEEEEEEEccHHHHHHHHcccccccHHcccEEEEEEEEEEEccccEEEEEEEEEccccEEEEEEEEEEEEcccccccEEEEEEEEEEEEEEEEccccccccccccEEEccEEEEEEEEEEEEEcc //